Recombinant Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_0663 (HI_0663)

Code CSB-CF300945HTA
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names HI_0663
Uniprot No. P71355
Alternative Names HI_0663; Uncharacterized ABC transporter ATP-binding protein HI_0663
Species Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Expression Region 1-560
Target Protein Sequence MLWNWVALVGGIISAVVFSYILQAAYFHELSLLSAVILGIVLIAALALRAFAGKKSVQAS YFASTKVKHELRSLIYRKLASMPLNQVNQQSTSSIIQVASEGVEQLEIYFGRYLPQLFYS LLAPLTLFAFLIFFSFKTAIILLICVPLIPMSIIAVNKIAKKLLAKYWSIYVGLGSSFLD NLQGLITLKIYQDDAYKAKAMDKEAEHFRKITMKVLTMQLNSVSLMDLLAYGGAAIGILT ALLQFQNAQLSVLGVILFILLSSEFFIPLRLLGSFFHVAMNGKAASDKIFTLLDTPVETQ QSAVDFEAKNNVQVEIKDLHFSYSEEKPAITGLNLSILPNQLSVFVGKSGCGKSTLVSLL MGFNKAQQGEILFNGQNALNIDRTSFYQKVSLVSHSSYVFKGTLRENMTMAKIDATDEQI YACLEQVNLAQFVRDNGGLDMQLLSRGANLSGGQIQRLALARALLHNAELYIFDEATSNI DVESEEIILQFIQQFKQQKTIVMISHRLANAVNADCINVLDQGKLIEQGTHKELMEKQGA YAEMFQQQKDLEQIREVANA
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily
Database Links

KEGG: hin:HI0663m

STRING: 71421.HI0663m

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1