Recombinant Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_0663 (HI_0663)

Code CSB-CF300945HTA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P71355
Storage Buffer Tris-based buffer,50% glycerol
Species Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Sequence MLWNWVALVGGIISAVVFSYILQAAYFHELSLLSAVILGIVLIAALALRAFAGKKSVQAS YFASTKVKHELRSLIYRKLASMPLNQVNQQSTSSIIQVASEGVEQLEIYFGRYLPQLFYS LLAPLTLFAFLIFFSFKTAIILLICVPLIPMSIIAVNKIAKKLLAKYWSIYVGLGSSFLD NLQGLITLKIYQDDAYKAKAMDKEAEHFRKITMKVLTMQLNSVSLMDLLAYGGAAIGILT ALLQFQNAQLSVLGVILFILLSSEFFIPLRLLGSFFHVAMNGKAASDKIFTLLDTPVETQ QSAVDFEAKNNVQVEIKDLHFSYSEEKPAITGLNLSILPNQLSVFVGKSGCGKSTLVSLL MGFNKAQQGEILFNGQNALNIDRTSFYQKVSLVSHSSYVFKGTLRENMTMAKIDATDEQI YACLEQVNLAQFVRDNGGLDMQLLSRGANLSGGQIQRLALARALLHNAELYIFDEATSNI DVESEEIILQFIQQFKQQKTIVMISHRLANAVNADCINVLDQGKLIEQGTHKELMEKQGA YAEMFQQQKDLEQIREVANA
Source in vitro E.coli expression system
Gene Names HI_0663
Protein Names Recommended name: Uncharacterized ABC transporter ATP-binding protein HI_0663
Expression Region 1-560
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily
Database Links

KEGG: hin:HI0663m

STRING: 71421.HI0663m

Related Products

HI_0663 Proteins

HI_0663 Proteins for Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.