Recombinant Human ATP synthase F(0) complex subunit a (MT-ATP6)

In Stock
Code CSB-CF015070HU
Abbreviation Recombinant Human MT-ATP6 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-226aa
Target Protein Sequence
MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.
Gene References into Functions
  1. we did not find somatic mutations in the sequence of the ATP6 and/or ND3 genes in postmenopausal Mexican-Mestizo women with breast cancer PMID: 29414393
  2. Results identified a mutation in the mitochondrial ATP6 gene, G8969>A in a patient with IgA nephropathy which leads to replacing of a highly conserved serine residue at position 148 of the a-subunit of ATP synthase. Increasing the mutation load in cybrid cell lines was paralleled by the appearance of abnormal mitochondrial morphologies, diminished respiration and enhanced production of reactive oxygen species. PMID: 27812026
  3. the MT-ATP6 and SURF1 gene screening in Tunisian patients affected with classical Leigh syndrome and the computational investigation of the effect of detected mutations on its structure and functions by clinical and bioinformatics analyses. PMID: 29481804
  4. Mitochondrial ATP synthase mutations, which accumulate during carcinogenesis process, may be significant for cancer cell escape from apoptosis. PMID: 28986220
  5. Interaction between mitochondrially encoded ATP synthase 6 (p.MT-ATP6) subunit and an environmental exposure of the ATP synthase inhibitor tributyltin chloride might contribute to the etiology of striatal necrosis syndromes. PMID: 27129022
  6. A novel frameshift mutation in the mitochondrial ATP6 gene was identified in a 4-year-old girl with ataxia, microcephaly, developmental delay and intellectual disability. PMID: 28412374
  7. Three mutations in the MT-ATP6 gene associated to the mitochondrial cardiomyopathy. PMID: 28104394
  8. ATP6 genetic polymorphisms associated with breast cancer in Mizoram mongloid population. PMID: 25896597
  9. genetic variants not associated with aggressive prostate cancer in overweight or obese Mexicans PMID: 27187822
  10. analysis of mitochondrial deletion and double mutations in the MT-ATP6 gene in Tunisian patients PMID: 26993169
  11. Two synonymous substitutions (mt.8614T>C and mt.8994G>A) in the mt-ATP6 gene may be associated with childhood obesity; study provides first data about mitochondrial genome variations in a Turkish obese population and also the first in obese children PMID: 25541891
  12. This study suggests that, in part, polymorphisms in the MT-ATP6 and MT-CYB genes may contribute to the unexpected fertilization failure. PMID: 24102627
  13. T8821G mutation of the ATPase6 is associated with Leber's hereditary optic neuropathy. PMID: 26252090
  14. Screening of the MT-ATP6 gene in a large collection of patients suspected of suffering different mitochondrial DNA (mtDNA) disorders. Biochemical, molecular-genetics and other analyses show three new pathologic mutations. PMID: 24986921
  15. Here, we report on a neonate with the m.8993 T>G mutation and emphasize implications of mtDNA disorders on family planning decisions. PMID: 25009317
  16. Five mutations able to change amino acid synthesis for the ATP synthase subunit 6 were associated with acute lymphoblastic leukemia in a Saudi Arabian cohort. PMID: 25556488
  17. identified 8 changes in ATP6 gene in 36/50 examined breast cancer cell samples and 5 changes in ATP8 gene (10/50); most were homoplasmic changes of missense type; 4 changes (A8439C, G8858C, C9130G and T9119G) had not been described in the literature before PMID: 25110199
  18. Lack of Atp6 (F0-a) alters the structure but not the content of ATP synthase. PMID: 25588698
  19. Case Report: absence of mtDNA-encoded ATPase6 and ATPase8 genes in progressive external ophthalmoplegia patient clearly resulted in aberrant synthesis of ATP synthase. PMID: 20082143
  20. Patients with irritable bowel syndrome with diarrhea have a higher incidence of MT-ATP 6 and 8 polymorphisms than healthy subjects, implying that the mtDNA polymorphism may play a role in irritable bowel syndrome with diarrhea. PMID: 23840124
  21. Mutations in mitochondrial DNA MT-ATP6/8 genes may be responsible for acute episodes of limb weakness. PMID: 24153443
  22. study reports the second known family with a rare, maternally inherited missense m.8851T>C mutation in the mitochondrial MTATP6 gene; novel laboratory and muscle biopsy findings in the patient and a new clinical presentation in her mother were observed PMID: 23206802
  23. Our findings reveal that an axonal Charcot Marie Tooth phenotype can be associated with mutations in the mitochondrial ATP6 gene PMID: 22971232
  24. data demonstrated that mtDNA mutations within the ATPase6 gene are a frequent event in Chinese patients with osteosarcoma PMID: 22542792
  25. A family members with m.8993T>C mutation in the mitochondrial MT-ATP6 gene have neuropathy ataxia and retinis pigmentosa/maternally inherited Leigh syndrome. PMID: 22819295
  26. We have shown that m.9185T>C in MT-ATP6 causes Charcot-Marie-Tooth disease type 2 in 1.1% of genetically undefined cases. PMID: 22933740
  27. study describes two families with adult-onset spinocerebellar ataxia due to mutations in MTATP6. PMID: 22577227
  28. Several genes expressed at exceptionally high levels were identified associated with early oocyte development, TMEFF2, the Rho-GTPase-activating protein oligophrenin 1 (OPHN1) and the mitochondrial-encoded ATPase6 (ATP6). PMID: 22238370
  29. genetic study of Leigh syndrome which showed a novel mutation at 8597T>C of the mitochondrial ATPase6 gene. PMID: 22348497
  30. differences in the biosynthesis and remodeling of cardiolipin at the level of the inner mitochondrial transmembrane related to some mutations of the ATP6 gene. PMID: 21993659
  31. Mitochondrial ATP6 point mutation associated with hereditary spastic paraplegia-like disorder. PMID: 20656066
  32. To gain insight into the primary pathogenic mechanisms induced by mtDNA Atp6p T9176C, we have investigated the consequences of this mutation on the ATP synthase of yeast where Atp6p is also encoded by the mtDNA. PMID: 20056103
  33. ATPase6 gene nucleotide alterations and elevated Reactive Oxygen Species levels occur in idiopathic cases of Primary ovarian insufficiency (POI) PMID: 20361200
  34. The authors report a rare mutation, m. 9185 T>C that gives rise to a progressive, but episodic pattern of neurological impairment with partial recovery in Leigh syndrome. PMID: 20546952
  35. Rescue of a deficiency in ATP synthesis by transfer of MTATP6, a mitochondrial DNA-encoded gene, to the nucleus PMID: 11925565
  36. ATP6L is upregulated in resonse to antineoplastic agents as an anti-apoptotic defense PMID: 12133827
  37. A mitochondrial DNA microdeletion removes the termination codon for MTATP6 and sets MTCO3 immediately in frame. PMID: 12915481
  38. mitochondrial ATP6 can use GUG as a functional initiation codon PMID: 14697245
  39. This work provides the first evidence that hyperpolarization of mitochondria may be a 'risk factor' for cells with a deep ATPase dysfunction, such as cells from patients with maternally-inherited Leigh syndrome PMID: 15228605
  40. 25 amino acids are probably the human-specific adaptation residues of ATP6 PMID: 15965056
  41. The spectrum of mutations causing Leigh syndrome and emphasize the role of MTATP6 gene mutations in pathogenesis of Leigh syndrome. PMID: 16217706
  42. The data also demonstrate that mutations in either of these genes may cause early deafness, and they highlight the importance of genetic screening for recessive forms of dRTA independent of hearing status. PMID: 16611712
  43. Hybrid ATP6 mRNAs, as the endogenous SOD2 mRNA, localize to the mitochondrial surface in human cells. PMID: 16751614
  44. ATP synthase dimers and higher homo-oligomers were observed for the first time, and it was demonstrated that the mutant enzymes retain enough structural integrity to oligomerize PMID: 17121862
  45. Reliability of preimplantation genetic diagnosis for T8993G mutation. PMID: 17342424
  46. These results possibly highlight the different pathogenic mechanism generated by the two mutations at position 8993 of ATPase 6 subunit of the mitochondrial ATP synthase complex. PMID: 17568559
  47. Point mutation occurred in mtDNA might be involved in pathogenesis of multiple sclerosis. PMID: 17619138
  48. In a 3-generation ataxic family with the m.8993T-->C mutation of mtDNA, 1 had episodic ataxia & transient hemipareses, broadening the phenotype. No further cases were identified in an additional cohort of 191 patients with suspected EA. PMID: 18055910
  49. mitochondrial 12S/MT-RNR1, MT-CO2/COX2, and MT-ATP6 transcripts is significantly decreased in prostate tumor samples PMID: 18409190
  50. This paper emphasises the role of MTATP6 in LS and expands the associated clinical phenotype further. PMID: 18461509

Show More

Hide All

Involvement in disease
Neuropathy, ataxia, and retinitis pigmentosa (NARP); Leber hereditary optic neuropathy (LHON); Leigh syndrome (LS); Mitochondrial infantile bilateral striatal necrosis (MIBSN); Mitochondrial complex V deficiency, mitochondrial 1 (MC5DM1); Myopathy, lactic acidosis, and sideroblastic anemia 3 (MLASA3); Ataxia and polyneuropathy, adult-onset (APAO); Cardiomyopathy, infantile hypertrophic (CMHI)
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
ATPase A chain family
Database Links

HGNC: 7414

OMIM: 256000

KEGG: hsa:4508

STRING: 9606.ENSP00000354632

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*