Recombinant Human BPI fold-containing family A member 1 (BPIFA1)

Code CSB-CF868269HU
Abbreviation Recombinant Human BPIFA1 protein
MSDS
Size $878
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
BPIFA1
Uniprot No.
Research Area
Cancer
Alternative Names
BPIFA1; LUNX; NASG; PLUNC; SPLUNC1; SPURT; UNQ787/PRO1606; BPI fold-containing family A member 1; Lung-specific protein X; Nasopharyngeal carcinoma-related protein; Palate lung and nasal epithelium clone protein; Secretory protein in upper respiratory tracts; Short PLUNC1; Tracheal epithelium-enriched protein; Von Ebner protein Hl
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
20-256aa
Target Protein Sequence
QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lipid-binding protein which shows high specificity for the surfactant phospholipid dipalmitoylphosphatidylcholine (DPPC). Plays a role in the innate immune responses of the upper airways. Reduces the surface tension in secretions from airway epithelia and inhibits the formation of biofilm by pathogenic Gram-negative bacteria, such as P.aeruginosa and K.pneumoniae. Negatively regulates proteolytic cleavage of SCNN1G, an event that is required for activation of the epithelial sodium channel (ENaC), and thereby contributes to airway surface liquid homeostasis and proper clearance of mucus. Plays a role in the airway inflammatory response after exposure to irritants. May attract macrophages and neutrophils.
Gene References into Functions
  1. Study proposes that BPIFA1 (SPLUNC1) is the epithelium-derived smooth muscle relaxing factor and it functions by internalizing Orai1. BPIFA1 deficiency in asthmatic airways promotes Orai1 hyperactivity, increased airway smooth muscle contraction and airway hyperresponsiveness. PMID: 28165446
  2. BPIFA1 and BPIFB1 expressions are correlated with goblet cell metaplasia and inversely correlated with lung function parameters of airway obstruction (FEV1 and FEV1/FVC) in COPD patients. PMID: 29296079
  3. SPLUNC1 has antimicrobial and antibiofilm activities against the Burkholderia cepacia complex. PMID: 27458217
  4. Data show that the palate, lung, and nasal epithelium clone (PLUNC) protein level was highly expressed in nontumor nasopharyngeal epithelium than that in nasopharyngeal carcinoma (NPC) tissues. PMID: 26654795
  5. These studies identify the role of SPLUNC1 in sinonasal innate immunity and the pathogenesis of CRS. Defective expression of SPLUNC1 in CRSwNP patients may lead to insufficient maintenance of the epithelial barrier function PMID: 26658012
  6. High serum SPLUNC1 levels are associated with Pleural Effusion from Lung Cancer Compared to Tuberculosis. PMID: 26090599
  7. PLUNC is a protein of the tear film and suggest that it plays a role in fluid balance and surface tension regulation at the ocular surface. PMID: 26559477
  8. SPLUNC1 can weaken the inflammatory response induced by EBV infection in NPC cells through the regulation of the TLR9/NF-kappaB signaling pathway and control of the tumor inflammatory microenvironment PMID: 25891128
  9. The G allele of rs1078761 may be detrimental to lung function in cystic fibrosis owing to decreased levels of BPIFA1 and BPIFB1. PMID: 25574903
  10. LUNX silencing disrupted primary tumor growth, local invasion, and metastatic colonization PMID: 25600649
  11. pleural fluid LUNX mRNA provided a valuable adjunct in distinguishing malignant pleural effusion caused by lung cancer from benign pleural effusion PMID: 25425729
  12. The observations suggest that, in response to agents or chemical factors, nasal mucosal epithelium will react and produce PLUNC proteins PMID: 25136695
  13. discoveries provide insight into the specific determinants governing the interaction between SPLUNC1 and lipids and also shed light on novel functions that SPLUNC1 and other PLUNC family members perform in host defense PMID: 25223608
  14. 12 retinoid X receptors heterodimer binding sites exist in the SPLUNC1 promoter region, which is up-regulated by all-trans-retinoic acid. SPLUNC1 plays a role in ATRA-induced growth inhibition and differentiation in nasopharyngeal carcinoma cells. PMID: 25161098
  15. Our results indicate that BPIFA1 is a novel target for autoantibodies in cystic fibrosis. PMID: 24269518
  16. The correlation between SPLUNC1 levels and Vol2(increase) in non-smokers may indicate involvement of SPLUNC1in the regulation of the normal function of the nasal mucosa. PMID: 24512783
  17. In patients with chronic rhinosinusitis with nasal polyps, decreased PLUNC expression is associated with multibacterial colonization, specifically those mediated by Staphyloccocus aureus and Pseudomonas aeruginosa. PMID: 23644997
  18. BPIFA1 protein displays bacteriocidal activity against Gram-negative bacteria. PMID: 21787346
  19. SPLUNC1 is differentially modulated in eosinophilic and noneosinophilic chronic rhinosinusitis with nasal polyps. PMID: 24342548
  20. High LUNX mRNA expression correlated with lung cancer stage and distant metastases. PMID: 23810363
  21. SPLUNC1 is a crucial component of mucosal innate immune defense against pulmonary infection. PMID: 23499554
  22. SPLUNC1 degradation by neutrophil elastase may increase airway susceptibility to bacterial infections. PMID: 23741370
  23. the epithelial sodium channel inhibitory domain of SPLUNC1 may be cleaved away from the main molecule by neutrophil elastase PMID: 24124190
  24. Data indicate that SPLUNC1 is an important component of mucosal innate immune defense against pulmonary inhaled particles. PMID: 23721177
  25. The changes in Lunx mRNA levels after chemotherapy can predict the prognosis of patients with MPEs caused by pulmonary carcinoma. PMID: 23759037
  26. SPLUNC1 regulates NPC cell proliferation, differentiation and apoptosis through miR-141, which in turn regulates PTEN and p27 expression, and is negatively regulated by LMP1 PMID: 23472073
  27. Short palate lung and nasal epithelial clone 1, the most abundant gene in airway epithelia, is the extracellular pH-sensitive factor that inhibits ENaC in normal but not cystic fibrosis airways. PMID: 24043776
  28. Sinusitis with positive P. aeruginosa bacterial culture is associated with decreased SPLUNC1 sinus mucosa expression. Repeated sinus surgeries are more frequently needed for these patients. PMID: 23371910
  29. P. aeruginosa treated with recombinant human SPLUNC1 protein showed decreased growth in vitro. PMID: 23132494
  30. genetic polymorphisms of SPLUNC1 protein confer risk of nasopharyngeal carcinoma in a Malaysian Chinese population PMID: 22213098
  31. Reduced expression of antimicrobial PLUNC proteins in nasal polyp tissues of patients with chronic rhinosinusitis PMID: 22676062
  32. RSV-positive boys had significantly less 25 kDa SPLUNC1 than RSV-negative boys while there were no significant differences among girls PMID: 21805676
  33. LUNX gene sequences from +3770 to +3959 bp and +14553 to +14652 bp possess the capacity to enhance gene transcription. PMID: 20855242
  34. The LUNX mRNA expression in the lymph nodes was closely related to the pathological type, cancer cell differentiation and clinical stage of non-small cell lung cancer. PMID: 21200090
  35. PLUNC is a multifunctional protein, which plays a novel role in airway defences at the air/liquid interface PMID: 21787339
  36. PLUNC transgene is associated with enhanced bacterial killing and decreased inflammation after exposure with a major human airway pathogen, the Gram-negative bacterium Pseudomonas aeruginosa, both in vitro and in vivo. PMID: 21632717
  37. Expression of Cu/ZnSOD and PLUNC in in chronic sinusitis was higher than in normal tissue, and expression in nasal polyp tissue was lower than in normal tissue. PMID: 19119597
  38. data have provided the first in vivo evidence that cSPLUNC1 functions to maintain homeostasis of the upper airway and, thereby, is critical for protection of the middle ear PMID: 20949060
  39. SPLUNC1 potently reduced surface levels of the epithelial sodium channel (ENaC)in bronchial epithelial cells and Xenopus laevis oocytes. PMID: 20519934
  40. Data suggest that the PLUNC protein contributes to the surfactant properties of airway secretions, and that this activity may interfere with biofilm formation by an airway pathogen. PMID: 20161732
  41. mRNA expression of LUNX, CK19 and CEA genes in the regional lymph nodes of NSCLC was significantly higher than that in those of benign lung diseases. PMID: 18646695
  42. members of the PLUNC family may function in the innate immune response in regions of the mouth, nose and lungs, which are sites of significant bacterial exposure PMID: 11971875
  43. results provide the cloning and characterization of a tissue-specific novel gene and its possible relationship with airway diseases PMID: 12409287
  44. There were three splicing variants in NASG 3'UTR. Its abnormal expression may be an important molecular event in NPC and lung cancer. PMID: 12753706
  45. SPLUNC1 is found to be down-expressed in 34 of 48 nasopharyngeal carcinoma biopsies. PMID: 12874788
  46. This study showed that plunc gene product is expressed both in vivo and in vitro, detailed a method for its purification and provided basic information on its biochemical properties in secretions. PMID: 12920053
  47. PLUNC proteins mediate host defense functions in the oral, nasal and respiratory epithelia [review]. PMID: 15313462
  48. SPLUNC1 protein is expressed at not only the serous glands and epithelium of the upper respiratory tract and digestive tract, but also in the oculi of embryos. PMID: 16195890
  49. This research sheds new light on the mechanism of SPLUNC1 involvement in the host upper respiratory tract defense system. PMID: 16364440
  50. SPLUNC1 is specifically and significantly increased in the epithelial cells of small airways of lungs from patients with cystic fibrosis. PMID: 17988392

Show More

Hide All

Subcellular Location
Secreted. Note=Apical side of airway epithelial cells. Detected in airway surface liquid, nasal mucus and sputum.
Protein Families
BPI/LBP/Plunc superfamily, Plunc family
Tissue Specificity
Highly expressed in lung, upper airways and nasopharyngeal regions, including trachea and nasal epithelium (at protein level). Specifically expressed in the secretory ducts and submucosal glands of tracheobronchial tissues (at protein level). Also express
Database Links

HGNC: 15749

OMIM: 607412

KEGG: hsa:51297

STRING: 9606.ENSP00000346251

UniGene: Hs.211092

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*