Recombinant Human C-X-C chemokine receptor type 2(CXCR2)

Code CSB-CF011673HU(A4)
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names CXCR2
Uniprot No. P25025
Alternative Names
C-X-C chemokine receptor type 2; CD 182; CD182; CD182 antigen; CDw128b; Chemokine (CXC) receptor 2; CMKAR2; CXC-R2; CXCR 2; CXCR-2; CXCR2; CXCR2_HUMAN; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL 8 receptor type 2; IL 8R B; IL-8 receptor type 2; IL-8R B; IL8 RB; IL8 receptor type 2; IL8R B; IL8R2; IL8RA; Interleukin 8 Receptor B; Interleukin 8 receptor; beta; Interleukin 8 receptor; type 2
Species Homo sapiens (Human)
Expression Region 1-360
Target Protein Sequence MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Gene References into Functions
  1. The CXCR2 rs1126579 TT genotype had a significantly increased possibility of HCV spontaneous clearance. PMID: 29948377
  2. CXCR2 protein expression was up-regulated in both the epileptic foci of temporal lobe epilepsy patients and in the pilocarpine mouse model. The CXCR2 selective antagonist SB225002, which was i.p. administered during the spontaneous recurrent seizures (SRSs) latency window preceding SRS onset, suppressed SRSs activity during the chronic period of epilepsy. PMID: 28705496
  3. results indicated that the CXCR2 +1208 CT genotype is less frequent in advanced stages of prostate cancer, suggesting that this chemokine receptor plays a role in the pathogenesis of this disease PMID: 28668699
  4. CXCR2 expression is a promoter of CRC local as well as distant metastasis and unfavorably associated with CRC patients' prognosis. Moreover, CXCR2 can stratify high-risk patients especially in normally early stage low-risk CRC patients. PMID: 28415702
  5. PADI4 contributes to gastric tumorigenesis by upregulating CXCR2, KRT14 and TNF-alpha expression. PMID: 27556695
  6. KHSV miR-K3 activates the GRK2/CXCR2/AKT axis inducing KSHV-induced angiogenesis and promoting KSHV latency. PMID: 27058419
  7. CXCR2 mRNA and protein expression levels were significantly decreased in preeclamptic placentas than normal control. The invasive abilities of the two trophoblast cell lines were significantly inhibited when CXCR2 was silenced, but that CXCR2 overexpression promoted trophoblast cells invasion. PMID: 27324095
  8. CXCR2 promotes breast cancer metastasis and chemoresistance via suppressing AKT1 and activating COX2. PMID: 28964785
  9. we conclude that CXCR2 is required for the recruitment of TANs, which in turn can suppress antitumor T-cell responses. We showed that CXCR2 ligands, particularly CXCL5, are elevated in both human and mouse PDA. PMID: 27737879
  10. this study shows that neutrophil expression levels of CVCR2 are decreased in septic patients PMID: 27016001
  11. CXCR4 and CXCR2 were highly expressed in a high invasive gastric cancer cell model and in gastric cancer tissues; crosstalk between CXCR4 and CXCR2 contributed to EMT, migration and invasion of gastric cancer. PMID: 28481874
  12. A unique viral protein, vCXCL1, which targets three chemokine receptors: CXCR1 and CXCR2 expressed on neutrophils and CXCR1 and CX3CR1 expressed on Natural killer cells. PMID: 27160907
  13. The expressions of CXCL1 in cancer cells and CXCR2 in stromal cells are useful prognostic factors for gastric cancer patients PMID: 28575019
  14. CXCR2 preferentially supports the maintenance of human pluripotent stem cell characteristics as well as facilitates ectodermal differentiation after the commitment to differentiation, and the mechanism might be associated with mTOR, beta-catenin, and hTERT activities. PMID: 27188501
  15. Our result showed that CXCR2 expression was correlated with high grade (P = 0.024), advanced stage (P = 0.029) and metastasis (P = 0.018). The log-rank test revealed that high CXCR2 and CXCR3 expressions are related to poorer overall survival (P < 0.001; P < 0.001). PMID: 27273823
  16. These data demonstrate that the CXCR2 network and CXCL4 play a role in the maintenance of normal HSC/HPC cell fates, including survival and self-renewal. PMID: 27222476
  17. CXCR1 and CXCR2 regulate hepatocyte exosome release. The mechanism utilized by CXCR1 remains elusive, but CXCR2 appears to modulate Nsm activity and resultant production of ceramide to control exosome release. CXCR1 is required for packaging of enzymes into exosomes that mediate their hepatocyte proliferative effect. PMID: 27551720
  18. TNF-alpha augments CXCR2 and CXCR3 to promote the progression of renal cell carcinoma leading to a poor prognosis. PMID: 27297979
  19. Data indicate that the crystal structure of PDZ-RhoGEF PDZ domain in complex with the CXC chemokine receptor 2 (CXCR2) C-terminal PDZ binding motif. PMID: 28179147
  20. Treatment with 1,25D3 increased poly(I:C)-induced IL-8 mRNA and protein expression after 2 to 6 hours. However, when cells were pretreated with 1,25D3 for 24 hours, 1,25D3 decreased cytokine expression PMID: 27196318
  21. we identified novel pathways associated with GPI-AP- granulocytes by RNA-seq and validated higher CXCR2 expression in GPI-AP- than GPI-AP+ granulocytes. PMID: 28151558
  22. Results identify the CXCL2/MIF-CXCR2 axis as an important mediator in MDSC recruitment and as predictors in bladder cancer. PMID: 27721403
  23. Study shows that CXCR2 signaling in the myeloid compartment is tumor promoting and required for pancreatic cancer metastasis. PMID: 27265504
  24. The usefulness of CXCR-2 as potential tumor marker of esophageal cancer was studied. PMID: 27906878
  25. this study shows that downregulation of CD182 after stimulation with IL-8 is more pronounced in adults than in neonates, whereas fMLP induces changes in receptor expression that are of the same magnitude in neutrophils from neonates as from adults PMID: 27606963
  26. findings present that miR-940 acts as a pivotal adaptor of CXCR2 and its transcription downregulated CXCR2 expression to decrease HCC invasion and migration in vitro. PMID: 27807540
  27. Our findings suggest that CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis. PMID: 26837773
  28. Data suggest that neutrophil-activating peptide 2 (NAP-2) secreted by NK cells can bind to CXC Chemokine Receptor 2 (CXCR2) on mesenchymal stem cells (MSCs) leading to stimulation of its recruitment. PMID: 27052313
  29. High CXCR2 expression is associated with pancreatic cancer. PMID: 26771140
  30. The results of this study show that the CXCR2 rs1126579 polymorphism is significantly associated with ischemic stroke, both individually and in combination with the genotype and/or alleles of other chemokine genes. PMID: 26648969
  31. These studies provide direct evidence linking the activation of IL8, DNA demethylation and the induction of the OA process with important therapeutic implications therein for patients with this debilitating disease. PMID: 26521741
  32. CXCR2 expression is enriched in human atherosclerotic coronary artery. PMID: 26287498
  33. CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinoma PMID: 26503598
  34. we found the mRNA level of NF-kappaB and IL-8 was higher in gastric ulcer patients, especially in patients with H.pylori-positive gastric ulcer. PMID: 26060478
  35. Study shows that CXCL5 expression is elevated in positive correlation to bladder cancer grade and promotes cell migration and invasion via binding to its receptor CXCR2. PMID: 26058729
  36. CXCR2 positivity combined with postoperative complications is associated with subsequent tumor recurrence in esophageal cancer. PMID: 26231560
  37. IL-10 rs1800896,CXCR2 rs1126579 and selected clinical features can be used as markers for septic shock development, but not for decreased survival. PMID: 26038959
  38. we investigated the changes in promoter methylation patterns using methylation arrays and observed that the promoters of immunomodulatory factors, COX2 and PTGES, and migration-related factors, CXCR2 and CXCR4, were hypomethylated after 5-aza treatment PMID: 25620445
  39. TLR3 stimulates the differentiation of mesenchymal stromal cells from human tonsils into follicular dendritic cell-like cells and induces chemokine secretion, possibly by recruiting C-X-C chemokine receptor 2-expressing immune cells. PMID: 25794662
  40. Data show that long ncRNAs MALAT1 silencing downregulated the expression of the microRNA miR-22-3p target gene CXCR2 and AKT pathway. PMID: 26364720
  41. Data revealed a critical role of a PDZ-based CXCR2 macromolecular complex in EPC homing and angiogenesis. PMID: 25622052
  42. Our results demonstrated that resistance to anti-proliferative effects of CXCR2 may also arise from feedback increases in MIP-2 secretion. PMID: 25682075
  43. CXCR2 is a potential independent adverse prognostic biomarker for recurrence and survival of patients with non-metastatic ccRCC after nephrectomy. PMID: 26188847
  44. The results showed that H. pylori induced the activation of Jak1/Stat3 and IL-8 production, which was inhibited by a Jak/Stat3 specific inhibitor AG490 in AGS cells in a dose-dependent manner PMID: 25837197
  45. Data indicate that the antibodies bound specifically to CXC chemokine receptor-2 (CXCR2) expressing cells. PMID: 25484047
  46. Data indicate the antibodies recognized distinct epitopes of CXC chemokine receptor-2 (CXCR2). PMID: 25484064
  47. our results reveal that circulating concentrations of IL-8 and IL-12 increase along with important vascular threatening traits as fasting serum glucose and VLDL-c, respectively PMID: 25456886
  48. miR141-CXCL1-CXCR2 signaling-induced Treg recruitment regulates metastases and survival of non-small cell lung cancer. PMID: 25349304
  49. 3'UTR SNP modulates CXCR2 expression, signaling, and susceptibility to lung cancer PMID: 25480945
  50. data demonstrate that CXCR2 regulates bone marrow blood vessel repair/regeneration and haematopoietic recovery, and clinically may be a therapeutic target for improving bone marrow transplantation. PMID: 25757087

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 6027

OMIM: 146928

KEGG: hsa:3579

STRING: 9606.ENSP00000319635

UniGene: Hs.846

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1