Recombinant Human C-X-C chemokine receptor type 2(CXCR2)

Code CSB-CF011673HU
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names CXCR2
Uniprot No. P25025
Alternative Names C-X-C chemokine receptor type 2; CD 182; CD182; CD182 antigen; CDw128b; Chemokine (CXC) receptor 2; CMKAR2; CXC-R2; CXCR 2; CXCR-2; CXCR2; CXCR2_HUMAN; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL 8 receptor type 2; IL 8R B; IL-8 receptor type 2; IL-8R B; IL8 RB; IL8 receptor type 2; IL8R B; IL8R2; IL8RA; Interleukin 8 Receptor B; Interleukin 8 receptor; beta; Interleukin 8 receptor; type 2
Species Homo sapiens (Human)
Expression Region 1-360
Target Protein Sequence MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Protein Length Full length protein
Tag Info The following tags are available.
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Gene References into Functions
  1. The CXCR2 rs1126579 TT genotype had a significantly increased possibility of HCV spontaneous clearance. PMID: 29948377
  2. CXCR2 protein expression was up-regulated in both the epileptic foci of temporal lobe epilepsy patients and in the pilocarpine mouse model. The CXCR2 selective antagonist SB225002, which was i.p. administered during the spontaneous recurrent seizures (SRSs) latency window preceding SRS onset, suppressed SRSs activity during the chronic period of epilepsy. PMID: 28705496
  3. results indicated that the CXCR2 +1208 CT genotype is less frequent in advanced stages of prostate cancer, suggesting that this chemokine receptor plays a role in the pathogenesis of this disease PMID: 28668699
  4. CXCR2 expression is a promoter of CRC local as well as distant metastasis and unfavorably associated with CRC patients' prognosis. Moreover, CXCR2 can stratify high-risk patients especially in normally early stage low-risk CRC patients. PMID: 28415702
  5. PADI4 contributes to gastric tumorigenesis by upregulating CXCR2, KRT14 and TNF-alpha expression. PMID: 27556695
  6. KHSV miR-K3 activates the GRK2/CXCR2/AKT axis inducing KSHV-induced angiogenesis and promoting KSHV latency. PMID: 27058419
  7. CXCR2 mRNA and protein expression levels were significantly decreased in preeclamptic placentas than normal control. The invasive abilities of the two trophoblast cell lines were significantly inhibited when CXCR2 was silenced, but that CXCR2 overexpression promoted trophoblast cells invasion. PMID: 27324095
  8. CXCR2 promotes breast cancer metastasis and chemoresistance via suppressing AKT1 and activating COX2. PMID: 28964785
  9. we conclude that CXCR2 is required for the recruitment of TANs, which in turn can suppress antitumor T-cell responses. We showed that CXCR2 ligands, particularly CXCL5, are elevated in both human and mouse PDA. PMID: 27737879
  10. this study shows that neutrophil expression levels of CVCR2 are decreased in septic patients PMID: 27016001
  11. CXCR4 and CXCR2 were highly expressed in a high invasive gastric cancer cell model and in gastric cancer tissues; crosstalk between CXCR4 and CXCR2 contributed to EMT, migration and invasion of gastric cancer. PMID: 28481874
  12. A unique viral protein, vCXCL1, which targets three chemokine receptors: CXCR1 and CXCR2 expressed on neutrophils and CXCR1 and CX3CR1 expressed on Natural killer cells. PMID: 27160907
  13. The expressions of CXCL1 in cancer cells and CXCR2 in stromal cells are useful prognostic factors for gastric cancer patients PMID: 28575019
  14. CXCR2 preferentially supports the maintenance of human pluripotent stem cell characteristics as well as facilitates ectodermal differentiation after the commitment to differentiation, and the mechanism might be associated with mTOR, beta-catenin, and hTERT activities. PMID: 27188501
  15. Our result showed that CXCR2 expression was correlated with high grade (P = 0.024), advanced stage (P = 0.029) and metastasis (P = 0.018). The log-rank test revealed that high CXCR2 and CXCR3 expressions are related to poorer overall survival (P < 0.001; P < 0.001). PMID: 27273823
  16. These data demonstrate that the CXCR2 network and CXCL4 play a role in the maintenance of normal HSC/HPC cell fates, including survival and self-renewal. PMID: 27222476
  17. CXCR1 and CXCR2 regulate hepatocyte exosome release. The mechanism utilized by CXCR1 remains elusive, but CXCR2 appears to modulate Nsm activity and resultant production of ceramide to control exosome release. CXCR1 is required for packaging of enzymes into exosomes that mediate their hepatocyte proliferative effect. PMID: 27551720
  18. TNF-alpha augments CXCR2 and CXCR3 to promote the progression of renal cell carcinoma leading to a poor prognosis. PMID: 27297979
  19. Data indicate that the crystal structure of PDZ-RhoGEF PDZ domain in complex with the CXC chemokine receptor 2 (CXCR2) C-terminal PDZ binding motif. PMID: 28179147
  20. Treatment with 1,25D3 increased poly(I:C)-induced IL-8 mRNA and protein expression after 2 to 6 hours. However, when cells were pretreated with 1,25D3 for 24 hours, 1,25D3 decreased cytokine expression PMID: 27196318
  21. we identified novel pathways associated with GPI-AP- granulocytes by RNA-seq and validated higher CXCR2 expression in GPI-AP- than GPI-AP+ granulocytes. PMID: 28151558
  22. Results identify the CXCL2/MIF-CXCR2 axis as an important mediator in MDSC recruitment and as predictors in bladder cancer. PMID: 27721403
  23. Study shows that CXCR2 signaling in the myeloid compartment is tumor promoting and required for pancreatic cancer metastasis. PMID: 27265504
  24. The usefulness of CXCR-2 as potential tumor marker of esophageal cancer was studied. PMID: 27906878
  25. this study shows that downregulation of CD182 after stimulation with IL-8 is more pronounced in adults than in neonates, whereas fMLP induces changes in receptor expression that are of the same magnitude in neutrophils from neonates as from adults PMID: 27606963
  26. findings present that miR-940 acts as a pivotal adaptor of CXCR2 and its transcription downregulated CXCR2 expression to decrease HCC invasion and migration in vitro. PMID: 27807540
  27. Our findings suggest that CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis. PMID: 26837773
  28. Data suggest that neutrophil-activating peptide 2 (NAP-2) secreted by NK cells can bind to CXC Chemokine Receptor 2 (CXCR2) on mesenchymal stem cells (MSCs) leading to stimulation of its recruitment. PMID: 27052313
  29. High CXCR2 expression is associated with pancreatic cancer. PMID: 26771140
  30. The results of this study show that the CXCR2 rs1126579 polymorphism is significantly associated with ischemic stroke, both individually and in combination with the genotype and/or alleles of other chemokine genes. PMID: 26648969
  31. These studies provide direct evidence linking the activation of IL8, DNA demethylation and the induction of the OA process with important therapeutic implications therein for patients with this debilitating disease. PMID: 26521741
  32. CXCR2 expression is enriched in human atherosclerotic coronary artery. PMID: 26287498
  33. CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinoma PMID: 26503598
  34. we found the mRNA level of NF-kappaB and IL-8 was higher in gastric ulcer patients, especially in patients with H.pylori-positive gastric ulcer. PMID: 26060478
  35. Study shows that CXCL5 expression is elevated in positive correlation to bladder cancer grade and promotes cell migration and invasion via binding to its receptor CXCR2. PMID: 26058729
  36. CXCR2 positivity combined with postoperative complications is associated with subsequent tumor recurrence in esophageal cancer. PMID: 26231560
  37. IL-10 rs1800896,CXCR2 rs1126579 and selected clinical features can be used as markers for septic shock development, but not for decreased survival. PMID: 26038959
  38. we investigated the changes in promoter methylation patterns using methylation arrays and observed that the promoters of immunomodulatory factors, COX2 and PTGES, and migration-related factors, CXCR2 and CXCR4, were hypomethylated after 5-aza treatment PMID: 25620445
  39. TLR3 stimulates the differentiation of mesenchymal stromal cells from human tonsils into follicular dendritic cell-like cells and induces chemokine secretion, possibly by recruiting C-X-C chemokine receptor 2-expressing immune cells. PMID: 25794662
  40. Data show that long ncRNAs MALAT1 silencing downregulated the expression of the microRNA miR-22-3p target gene CXCR2 and AKT pathway. PMID: 26364720
  41. Data revealed a critical role of a PDZ-based CXCR2 macromolecular complex in EPC homing and angiogenesis. PMID: 25622052
  42. Our results demonstrated that resistance to anti-proliferative effects of CXCR2 may also arise from feedback increases in MIP-2 secretion. PMID: 25682075
  43. CXCR2 is a potential independent adverse prognostic biomarker for recurrence and survival of patients with non-metastatic ccRCC after nephrectomy. PMID: 26188847
  44. The results showed that H. pylori induced the activation of Jak1/Stat3 and IL-8 production, which was inhibited by a Jak/Stat3 specific inhibitor AG490 in AGS cells in a dose-dependent manner PMID: 25837197
  45. Data indicate that the antibodies bound specifically to CXC chemokine receptor-2 (CXCR2) expressing cells. PMID: 25484047
  46. Data indicate the antibodies recognized distinct epitopes of CXC chemokine receptor-2 (CXCR2). PMID: 25484064
  47. our results reveal that circulating concentrations of IL-8 and IL-12 increase along with important vascular threatening traits as fasting serum glucose and VLDL-c, respectively PMID: 25456886
  48. miR141-CXCL1-CXCR2 signaling-induced Treg recruitment regulates metastases and survival of non-small cell lung cancer. PMID: 25349304
  49. 3'UTR SNP modulates CXCR2 expression, signaling, and susceptibility to lung cancer PMID: 25480945
  50. data demonstrate that CXCR2 regulates bone marrow blood vessel repair/regeneration and haematopoietic recovery, and clinically may be a therapeutic target for improving bone marrow transplantation. PMID: 25757087
  51. CXCL7/CXCR2 signalling pathways are a predictive factor of poor outcome in metastatic colon cancer. PMID: 25580640
  52. The higher expression of IL-8R2 was found in early esophageal carcinoma, which may indicate that IL-8R2 plays an important role and is better prognostic factor in esophageal cancer development. PMID: 24972913
  53. ADAM17 induction down-regulates the receptor in an irreversible manner and may serve as a master switch in controlling CXCR2 function. PMID: 25412626
  54. our data showed that the CXCR2/CXCL5 axis contributes to EMT of HCC cells through activating PI3K/Akt/GSK-3beta/Snail signaling, and it may serve as a potential therapeutic target. PMID: 25462858
  55. augmentation of proinflammatory chemokines CXCL1/2, by potentiating NF-kappaB activation through EGFR-transactivated Akt, contributes to CXCR2-driven ovarian cancer progression PMID: 24376747
  56. Pro-inflammatory cytokines activate CXC receptor-2 stimulated by IL-8 and CXCL1 to induce neutrophil transmigration. PMID: 24989774
  57. CXCR2 ubiquitination on K327 residue modulates agonist-activated CXCR2 cell sorting and intracellular signaling. PMID: 25339290
  58. HIV matrix protein p17 is pro-fibrogenic through its interactions both with CXCR2 and syndecan-2 on activated HSCs PMID: 24736615
  59. The silencing of the pro-angiogenic chemokine GRO-alpha is proportionally correlated with decreased expression of CXCR2 in pro-inflammatory cytokine-stimulated SGEC indicating the GRO-alpha/CXCR2 complex as a novel therapeutic target for Sjogren's syndrome. PMID: 23052840
  60. Expression of AP2-sigma2 V88D and V98S dominant negative mutants resulted in loss of CXCR2 mediated chemotaxis PMID: 24450359
  61. CXCR2 signaling contributes to the metastatic immunophenotype of renal cell carcinoma cells. PMID: 24593195
  62. New conformational state of NHERF1-CXCR2 signaling complex captured by crystal lattice trapping. PMID: 24339979
  63. the structural basis for the PDZ domain-mediated NHERF1-CXCR2 interaction PMID: 24768637
  64. High expression of CXCR2 correlates with lymph node metastasis in esophageal carcinoma. PMID: 24338377
  65. analysis of mutations in CXCR2 and their role in hematological traits PMID: 24777453
  66. polymorphism in CXCR2C1208T and CXCL12G801A showed high risk for breast cancer in north Indian population. However, CCR532 exhibited no association. PMID: 24430363
  67. the cellular senescence caused by CXCR2 upregulation depends on p53 and is mediated by p38 activation. PMID: 23869868
  68. Blockage of CXCR2 suppresses tumor growth of intrahepatic cholangiocellular carcinoma. PMID: 24582495
  69. This study provides an understanding of the structural basis for the PDZ-mediated NHERF1-PLCbeta3 interaction that could prove valuable in selective drug design against CXCR2-related cancers. PMID: 24642259
  70. Data indicate that three genes, namely Chemokine (C-X-C motif) receptor 2 (CXCR2), C-C chemokine receptor type 2 (CCR2) and E1A-Binding Protein P400 (EP400), were able to identify HCC individually with accuracies of 82.4%, 78.4% and 65%, respectively. PMID: 24332572
  71. these results indicate that GRK6 complexes with AGS3-Galphai2 to regulate CXCR2-mediated leukocyte functions at different levels, including downstream effector activation, receptor trafficking, and expression at the cell membrane. PMID: 24510965
  72. these results indicated that polymorphism in CXCL12G801A and CXCR2(+1208)C/T showed high risk for end-stage renal disease in North Indian population. PMID: 23615182
  73. CCR6 and CXCR2 were higher in the colorectal metastasis group than in the non-metastasis group, but there was no difference between the lung and liver metastasis subgroups. CXCR4 was not different between the metastasis and non-metastasis groups. PMID: 23758411
  74. findings of the current study suggest a broad involvement of the chemokine GRO-alpha/CXCR2 system in Sjogren's syndrome pathogenesis that is mediated by the involvement of ADAM17 PMID: 23389772
  75. the CXCR-2 +1208 C>T polymorphism is an independent prognostic marker in patients with squamous cell lung carcinoma and is associated with aggressive tumor biology and shorter disease-free survival PMID: 23548249
  76. VEGFR-2 and PAR-1 polymorphisms predicted longer disease-free survival and overall survival in pancreatic carcinoma. CXCR-2 polymorphism was a negative predictor for disease-free survival. PMID: 23293110
  77. Dual antagonism of CXCR2 inhibits neutrophil chemotaxis in alveolar macrophages from chronic obstructive pulmonary disease patients. PMID: 23912333
  78. A biologically active natural product, triptolide, mediates a protective effect by inhibiting CXCR2 activity. PMID: 22986777
  79. expression of CXCR2 is associated with the development and progression of expression of CXCR2 is associated with the development and progression of laryngeal squamous cell carcinoma (LSCC). PMID: 22274915
  80. Chemokine CXCL1 dimer is a potent agonist for the CXCR2 receptor. PMID: 23479735
  81. These results indicate that macrophage-derived Cxcr2 ligands may be important for promoting mammary tumor formation regulated by FGFR signaling. PMID: 22893608
  82. Data show that mesenchymal stem cells (MSCs) directly regulate T cell proliferation by induction of CXCL3 chemokine and its receptor, CXCR2 on the surface in T cells. PMID: 23023221
  83. CXCR2 axis gene expression profiles in human NSCLC cell lines and lung adenocarcinomas defined a cluster driven by CXCL5 and associated with smoking, poor prognosis, and RAS pathway activation. PMID: 23204236
  84. Staphopain A is an important immunomodulatory protein that blocks neutrophil recruitment by specific cleavage of the N-terminal domain of human CXCR2 PMID: 22850671
  85. The data do not support the hypothesis that bronchoepithelial expression of CXCR2 facilitates transepithelial migration of neutrophils PMID: 22076427
  86. Expression levels of CXCR2 and IL-6Ralpha were not changed in comparison with normal fallopian tubes in tubal pregnancy. PMID: 22763101
  87. These data suggests an important role for CXCR2 receptors in oral squamous cell carcinoma. PMID: 21670971
  88. Our data implicate IL-8/CXCR2 signaling pathway in the progression and regulation of angiogenesis in astrocytomas and provide a rationale for CXCR2 therapeutic exploitation in these tumors PMID: 22231733
  89. The N-terminal element of the CXCR2 receptor, when attached to the N-terminus of the stabilized B1 domain, binds to IL-8. This binding is characterized by a small favorable enthalpy change and a larger favorable entropy change. PMID: 22242662
  90. PDZ scaffold protein NHERF1 couples CXCR2 to its downstream effector phospholipase C (PLC)-beta2, forming a macromolecular complex PMID: 22203670
  91. A novel allosteric binding cavity in the transmembrane domain of CXCR2 is identified at the same interface postulated as the ligand entry channel in the opsin receptor. PMID: 21948388
  92. IQGAP1 is a novel essential component of the CXCR2 "chemosynapse". PMID: 21876773
  93. the role of the IL8RA gene in atopic bronchial asthma. PMID: 22117410
  94. The expression of CXCL1 and CXCR2 was higher in gastric cancer tissues compared with adjacent noncancerous tissues. PMID: 21343381
  95. CXCR1 and CXCR2 are important factors in mediating the migration of endothelial cells induced by shear stress. PMID: 19634663
  96. CXCR2 mediates the atherogenic activity of environmental pollutants, such as dioxins, and contributes to the development of atherosclerosis through the induction of a vascular inflammatory response by activating the AhR-signaling pathway. PMID: 21441140
  97. LASP-1 interaction with CXCR2 is critical for CXCR2-mediated chemotaxis PMID: 20419088
  98. CXCR2 was able to promote invasion and metastasis of hepatocellular carcinoma PMID: 20018298
  99. the N-like loop in MIF is critical for MIF's noncognate interaction with CXCR2 and proatherogenic functions; the 2-site binding model that explains chemokine receptor activation also applies to MIF PMID: 21106938
  100. lower percentages of positive leukocytes in patients with pulmonary tuberculosis PMID: 20635912

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 6027

OMIM: 146928

KEGG: hsa:3579

STRING: 9606.ENSP00000319635

UniGene: Hs.846

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1