Recombinant Human C-X-C chemokine receptor type 2(CXCR2),partial

Code CSB-EP011673HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P25025
Relevance Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CDw128b GRO/MGSA receptor High affinity interleukin-8 receptor B Short name: IL-8R B IL-8 receptor type 2 CD_antigen: CD182
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
Research Area Signal Transduction
Source E.coli
Gene Names CXCR2
Expression Region 1-40aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 20.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 6027

OMIM: 146928

KEGG: hsa:3579

STRING: 9606.ENSP00000319635

UniGene: Hs.846

Pathway Chemokine signaling pathway
Oxidative Phosphorylation
Phospholipase D signaling pathway
Endocytosis

Related Products

CXCR2 Antibodies

CXCR2 Antibodies for Homo sapiens (Human)

CXCR2 Antibodies for Human

CXCR2 Proteins

CXCR2 Proteins for Homo sapiens (Human)

CXCR2 ELISA Kit

CXCR2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.