Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF837855HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q8WV48 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Sequence | DRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGALYTAAVAAFVLYKC LQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTTLAGA QQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEAS RPLPEDFCLKEDEEEIGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHS LGWEGGTTAEGRLKQSLFS |
| Source | in vitro E.coli expression system |
| Gene Names | CCDC107 |
| Protein Names | Recommended name: Coiled-coil domain-containing protein 107 |
| Expression Region | 25-283 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full Length of Mature Protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Subcellular Location | Membrane, Single-pass membrane protein |
| Database Links |
HGNC: 28465 KEGG: hsa:203260 UniGene: Hs.745107 |
CCDC107 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP837855HU1 CSB-EP837855HU1 CSB-BP837855HU1 CSB-MP837855HU1 |
Recombinant Human Coiled-coil domain-containing protein 107(CCDC107) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Proteasome activator complex subunit 1(PSME1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Peroxisome proliferator-activated receptor gamma(Pparg)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Rab GDP dissociation inhibitor beta(GDI2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Nuclear receptor ROR-gamma(Rorc)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Nuclear cap-binding protein subunit 2(NCBP2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase(GAPDH)
Express system: E.coli
Species: Homo sapiens (Human)
