Recombinant Human Coiled-coil domain-containing protein 107(CCDC107)

Code CSB-CF837855HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8WV48
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence DRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGALYTAAVAAFVLYKC LQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTTLAGA QQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEAS RPLPEDFCLKEDEEEIGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHS LGWEGGTTAEGRLKQSLFS
Source in vitro E.coli expression system
Gene Names CCDC107
Protein Names Recommended name: Coiled-coil domain-containing protein 107
Expression Region 25-283
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Database Links

HGNC: 28465

KEGG: hsa:203260

UniGene: Hs.745107

Related Products

CCDC107 Proteins

CCDC107 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.