Recombinant Human G-protein coupled receptor 35 (GPR35)-VLPs

Code CSB-MP881023HU
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
GPR35; G-protein coupled receptor 35; Kynurenic acid receptor; KYNA receptor
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-309aa
Target Protein Sequence
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.
Gene References into Functions
  1. We performed a label-free kinome short hairpin RNA screen and identified a putative signaling network of GPR35 in HT-29 cells, some of which was validated using gene expression, biochemical and cellular assays. The results showed that GPR35 induced hypoxia-inducible factor 1alpha, and was involved in synaptic transmission, sensory perception, the immune system, and morphogenetic processes. PMID: 28425521
  2. Using exome array data, we identified GPR35 as a novel susceptibility gene associated with chronic AIC in pediatric cancer patients PMID: 28961156
  3. GPR35 interacts with CXCL17 in breast cancer cells. PMID: 28943434
  4. Small molecules that stimulate or block GPR35 activity can modulate vascular proliferation and migration. PMID: 27064272
  5. This article shows that GPR35 is the receptor of CXCL17. PMID: 25411203
  6. Single-nucleotide polymorphism in GPR35 gene is associated with Crohn's disease. PMID: 25489960
  7. results clearly show that R4.60, R(164), R(167), and R6.58 play crucial roles in the agonist initiated activation of GPR35. PMID: 24347166
  8. GPR35 shows associations in both ulcerative colitis (UC) and primary sclerosing cholangitis (PSC), whereas TCF4 represents a PSC risk locus not associated with UC. Both loci may represent previously unexplored aspects of PSC pathogenesis. PMID: 22821403
  9. This review presents a summary of what is known about the G-protein coupled receptors GPR35 and GPR55 and their potential characterization as lysophospholipid or cannabinoid receptors, respectively--{REVIEW} PMID: 22820167
  10. screening assays used to identification of small MW agonists; some compounds are species-specific agonists; agonists/ligands include zaprinast, cromolyn & dicumarol PMID: 20919992
  11. human iNKT cells express GPR35 functionally active in reducing IL-4 release. PMID: 20599711
  12. These results strongly suggest that 2-acyl lysophosphatidic acid is an endogenous ligand for GPR35. PMID: 20361937
  13. The results of the study demonstrate the coupling of GPR35 to endogenous G proteins that modulate neuronal Ca2+ channel and thereby provide evidence for a potential role of GPR35 in regulating neuronal excitability and synaptic transmission PMID: 17940199

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Internalized to the cytoplasm after exposure to kynurenic acid.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Predominantly expressed in immune and gastrointestinal tissues.
Database Links

HGNC: 4492

OMIM: 602646

KEGG: hsa:2859

STRING: 9606.ENSP00000415890

UniGene: Hs.112218

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*