Product Details

Target Names

GPR35

Uniprot No.

Q9HC97

Research Area

Neuroscience

Alternative Names

GPR35; G-protein coupled receptor 35; Kynurenic acid receptor; KYNA receptor

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-309aa

Target Protein Sequence

MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Tag Info

C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.

Form

Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.

Buffer

Lyophilized from PBS, 6% Trehalose, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.

Gene References into Functions

We performed a label-free kinome short hairpin RNA screen and identified a putative signaling network of GPR35 in HT-29 cells, some of which was validated using gene expression, biochemical and cellular assays. The results showed that GPR35 induced hypoxia-inducible factor 1alpha, and was involved in synaptic transmission, sensory perception, the immune system, and morphogenetic processes. PMID: 28425521
Using exome array data, we identified GPR35 as a novel susceptibility gene associated with chronic AIC in pediatric cancer patients PMID: 28961156
GPR35 interacts with CXCL17 in breast cancer cells. PMID: 28943434
Small molecules that stimulate or block GPR35 activity can modulate vascular proliferation and migration. PMID: 27064272
This article shows that GPR35 is the receptor of CXCL17. PMID: 25411203
Single-nucleotide polymorphism in GPR35 gene is associated with Crohn's disease. PMID: 25489960
results clearly show that R4.60, R(164), R(167), and R6.58 play crucial roles in the agonist initiated activation of GPR35. PMID: 24347166
GPR35 shows associations in both ulcerative colitis (UC) and primary sclerosing cholangitis (PSC), whereas TCF4 represents a PSC risk locus not associated with UC. Both loci may represent previously unexplored aspects of PSC pathogenesis. PMID: 22821403
This review presents a summary of what is known about the G-protein coupled receptors GPR35 and GPR55 and their potential characterization as lysophospholipid or cannabinoid receptors, respectively--{REVIEW} PMID: 22820167
screening assays used to identification of small MW agonists; some compounds are species-specific agonists; agonists/ligands include zaprinast, cromolyn & dicumarol PMID: 20919992
human iNKT cells express GPR35 functionally active in reducing IL-4 release. PMID: 20599711
These results strongly suggest that 2-acyl lysophosphatidic acid is an endogenous ligand for GPR35. PMID: 20361937
The results of the study demonstrate the coupling of GPR35 to endogenous G proteins that modulate neuronal Ca2+ channel and thereby provide evidence for a potential role of GPR35 in regulating neuronal excitability and synaptic transmission PMID: 17940199