Code | CSB-CF016359HU |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | OPRK1 |
Uniprot No. | P41145 |
Species | Homo sapiens (Human) |
Expression Region | 1-380 |
Target Protein Sequence | MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV RNTVQDPAYLRDIDGMNKPV |
Protein Length | Full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | G-protein coupled opioid receptor that functions as receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins. Also functions as receptor for various synthetic opioids and for the psychoactive diterpene salvinorin A. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain. Plays a role in mediating reduced physical activity upon treatment with synthetic opioids. Plays a role in the regulation of salivation in response to synthetic opioids. May play a role in arousal and regulation of autonomic and neuroendocrine functions. |
Subcellular Location | Cell membrane, Multi-pass membrane protein |
Protein Families | G-protein coupled receptor 1 family |
Tissue Specificity | Detected in brain and placenta. |
Database Links |
HGNC: 8154 OMIM: 165196 KEGG: hsa:4986 STRING: 9606.ENSP00000265572 UniGene: Hs.106795 |
Recombinant Human HLA class I histocompatibility antigen, alpha chain G(HLA-G)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Versican core protein(VCAN),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Plasminogen activator inhibitor 2 type A(Serpinb2)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human Keratin, type II cytoskeletal 7(KRT7)
Express system: E.coli
Species: Homo sapiens (Human)