Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF016359HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P41145 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Sequence | MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV RNTVQDPAYLRDIDGMNKPV |
| Source | in vitro E.coli expression system |
| Gene Names | OPRK1 |
| Protein Names | Recommended name: Kappa-type opioid receptor Short name= K-OR-1 Short name= KOR-1 |
| Expression Region | 1-380 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | G-protein coupled opioid receptor that functions as receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins. Also functions as receptor for various synthetic opioids and for the psychoactive diterpene salvinorin A. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain. Plays a role in mediating reduced physical activity upon treatment with synthetic opioids. Plays a role in the regulation of salivation in response to synthetic opioids. May play a role in arousal and regulation of autonomic and neuroendocrine functions. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family |
| Tissue Specificity | Detected in brain and placenta. |
| Database Links |
HGNC: 8154 OMIM: 165196 KEGG: hsa:4986 STRING: 9606.ENSP00000265572 UniGene: Hs.106795 |
OPRK1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA016359OC01HU | OPRK1 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA016359OD01HU | OPRK1 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA016359OB01HU | OPRK1 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA016359OA01HU | OPRK1 Antibody | Human | ELISA, IHC, IF |
| CSB-PA020191 | OPRK1 Antibody | Human,Mouse,Rat,Monkey | WB,ELISA |
OPRK1 Antibodies for
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA000643 | Phospho-OPRK1 (S369) Antibody | Mouse,Rat | WB,IHC,ELISA |
| CSB-PA006351 | OPRK1 Antibody | Mouse,Rat | IHC,ELISA |
OPRK1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP016359HU1 CSB-EP016359HU1 CSB-BP016359HU1 CSB-MP016359HU1 |
Recombinant Human Kappa-type opioid receptor(OPRK1),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Androgen receptor(AR) ,partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Interferon regulatory factor 5(Irf5)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit(PPP1CB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Transcription elongation factor SPT4(SUPT4H1)
Express system: E.coli
Species: Homo sapiens (Human)
