Recombinant Human Peripherin-2 (PRPH2)

Code CSB-CF018775HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PRPH2
Uniprot No.
Alternative Names
PRPH2; PRPH; RDS; TSPAN22; Peripherin-2; Retinal degeneration slow protein; Tetraspanin-22; Tspan-22
Species
Homo sapiens (Human)
Expression Region
1-346
Target Protein Sequence
MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIELRKRSDVMNNSESHFV PNSLIGMGVLSCVFNSLAGKICYDALDPAKYARWKPWLKPYLAICVLFNIILFLVALCCF LLRGSLENTLGQGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQITNNSAHYSYDHQT EELNLWVRGCRAALLSYYSSLMNSMGVVTLLIWLFEVTITIGLRYLQTSLDGVSNPEESE SESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGAGAGQAPEAG
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for retina photoreceptor outer segment disk morphogenesis, may also play a role with ROM1 in the maintenance of outer segment disk structure. Required for the maintenance of retinal outer nuclear layer thickness. Required for the correct development and organization of the photoreceptor inner segment.
Gene References into Functions
  1. Novel C165R mutation of retinal degeneration slow/peripherin gene in family affected by different patterns of retinal dystrophy. PMID: 17851265
  2. Multiple genes contributing to the retinal dystrophy genotypes within a family were discovered using retinal gene-targeted next-generation sequencing. Families with noted examples of phenotypic variation or apparent non-penetrant individuals may offer a clue to suspect complex inheritance. PMID: 28761320
  3. These results suggest that genetic variants in PRPH2 do not compose a major genetic risk factor for adult-onset foveomacular vitelliform dystrophy (AFVD). The Israeli population shows a higher percentage of minor allele frequencies in SNPs in the PRPH2 gene, as compared with other populations. PMID: 26849151
  4. ablation of Rom1 results in the conversion of an MD/PD phenotype characterized by cone functional defects and the formation of abnormal Prph2/Rom1 complexes to an RP phenotype characterized by rod-dominant functional defects and reductions in total Prph2 protein. Thus one method by which ROM1 may act as a disease modifier is by contributing to the large variability in PRPH2-associated disease phenotype PMID: 28053051
  5. These results support the idea that mutations may differentially affect Prph2's role as a structural component, and its role as a functional protein key for organizing membrane domains for cellular signalling. These roles may be different in rods and cones, thus contributing to the phenotypic heterogeneity that characterizes diseases associated with Prph2 mutations. PMID: 27365499
  6. there are phenotypic variabilities of late-onset or nonpenetrance in individuals who carried the R172W mutation of the PRPH2 gene. The phenotypes ranged from severe cone-rod dystrophy to asymptomatic individuals with normal retinal function PMID: 27977834
  7. This review reveled that The PRPH2/RDS protein is a critical component for normal vision through its role as a structural protein important for the proper formation of both rod and cone photoreceptor cells. PMID: 26773759
  8. Of the 225 genetic tests performed, 150 were for recessive IRD, and 75 were for dominant IRD. A positive molecular diagnosis was made in 70 (59%) of probands with recessive IRD and 19 (26%) probands with dominant IRD. Thirty-two novel variants were identified; among these, 17 sequence changes in four genes were predicted to be possibly or probably damaging including: ABCA4 (14), BEST1 (2), PRPH2 (1), and TIMP3 PMID: 28005406
  9. In the control group, four different genetic variations were detected in ELOVL4, and five in PRPH2. STGD patients of different ethnicities may carry distinct ELOVL4 and PRPH2 sequence variants. We believe that the genetic variations identified in this study may be related to STGD etiopathogenesis. PMID: 27813578
  10. The PRPH2 c.828+3A>T mutation results in multiple distinct phenotypes likely modified by protein haplotypes in trans. PMID: 26842753
  11. Bi-allelic PRPH2 mutations cause a distinct Leber congenital amaurosis phenotype in infancy; affected adults have prominent maculopathy. PMID: 26061163
  12. Our data suggest that upregulation of PRPH2 levels in combination with defects in the PRPH2 function caused by the mutation might be an important mechanism leading to cone degeneration PMID: 26796962
  13. Studies indicate that mutations in the photoreceptor specific gene retina degeneration slow (RDS; peripherin-2) lead to a variety of retinal degenerative diseases. PMID: 26427414
  14. reason for high qAF among many PRPH2/RDS-positive patients is not known; higher RPE lipofuscin accumulation may be a primary or secondary effect of the PRPH2/RDS mutation PMID: 26024099
  15. The PRPH2 c.828+3A>T splice site mutation is a frequent cause of inherited retinal dystrophies and is owing to the founder effect. PMID: 25675413
  16. The mutations in PRPH2 account for 10.3% of adRP in the French population, which is higher than previously reported (0%-8%) This makes PRPH2 the second most frequent adRP gene after RHO in our series. PMID: 25447119
  17. This article reports a group of patients with molecularly confirmed mutations in the PRPH2 gene and (electro-) negative electroretinograms, an abnormality usually associated with inner retinal dysfunction. PMID: 24608669
  18. Novel mutation c.389T > C (p.Leu130Pro) in PRPH2 was found in patients with retinitis pigmentosa and hearing loss. PMID: 22842402
  19. 5 single nucleotide polymorphisms (SNPs: rs3812153, rs7764439, rs390659, rs434102 and c:929G>A) were detected in PRPH2. PMID: 22948568
  20. This is the first report of marked intrafamilial variation of pattern dystrophy because of peripherin/RDS Y141C mutation. Intravitreal ranibizumab injections might be a valuable treatment for associated subfoveal choroidal neovascularization. PMID: 22466463
  21. Mutation in PRPH2 gene is associated with Stargardt Disease. PMID: 22863181
  22. Molecular screening of the candidate genes BEST1 and PRPH2 revealed no mutations. PMID: 22174098
  23. PRPH2 screening should be recommended to patients with an age of onset more than 40 years. For an onset between 30 and 40 years, PRPH2 can be screened if no mutation has been detected in BEST1. PMID: 21269699
  24. Four mutations of the PRPH2 gene were found in 3 sporadic cases and 3 families (n = 11). A p.R46X mutation, previously described in CACD, was found in 3 members of a family with AOFVD and in a sporadic case with DMD. PMID: 20213611
  25. peripherin/RDS mutations produced diffuse AF abnormalities, disruption of the photoreceptor/RPE junction, and increased cone spacing, consistent with cone loss in the macula. PMID: 21071739
  26. The patient's DNA contained a mutation within the peripherin/RDS gene (CAG>TAG nucleotide substitution) in the coding sequence of exon 3, resulting in the diagnosis of pattern dystrophy. PMID: 20458258
  27. Families showing a variable macular dystrophy phenotype caused by mutations in PRPH2 should be tested for additional mutations in ABCA4 and ROM1, as they may alter the progression of the PRPH2 phenotype. PMID: 20335603
  28. The structure of peripherin/RDS and of a pathogenic mutant is assessed spectroscopically for the first time. PMID: 19921174
  29. Five novel rhodopsin mutations were c.365A>G in exon 2 (Glu122Gly), and c.233A> in exon 1 (Asn78Ile). The other three RHO mutations were Phe45Leu, Arg135Trp, and Ser186Trp. No peripherin/RDS gene mutations were demonstrated in the remaining 23 probands. PMID: 19958124
  30. This study describes a new RDS/peripherin mutation for BPD and provides the first combined genetic-pathological study of this condition. PMID: 11934323
  31. This review describes the role of peripherin in vision, specifically, disk morphogenesis. PMID: 12019563
  32. A frameshift null mutation in the RDS/Peripherin gene associated with a relatively severe manifestation of adult-onset foveomacular dystrophy in affected family members. PMID: 12566026
  33. Autosomal dominant macular dystrophy is described in a large family with an Arg172Trp mutation in the RDS gene. PMID: 12608515
  34. This study reveals that genetic heterogeneity for BSMD (butterfly-shaped macular dystrophy) is not associated with a mutation in the peripherin/RDS gene nor with any other known non-syndromic retinal disease gene. PMID: 12724643
  35. The RDS mutation in codon 141 is associated with an unusual age-related macular degeneration-like late-onset maculopathy. PMID: 12882809
  36. Peptide mass-signature genotyping applied to the RDS/peripherin gene of 16 individuals from a family exhibiting autosomal dominant macular degeneration revealed an A-->T transversion in the 5' splice site of intron 2 that is the likely cause of disease. PMID: 12902384
  37. A deletion of Asn169 in the peripherin/RDS protein causes a peculiar form of autosomal dominant macular dystrophy in a large family from the Netherlands. PMID: 14557182
  38. Autosomal dominant central areolar choroidal dystrophy and a novel Arg195Leu mutation in the peripherin/RDS gene. PMID: 14557183
  39. Peripherin gene mutation associated with diverse macular phenotypes PMID: 15370544
  40. Proline at position 296 is necessary for optimal function. PMID: 15591062
  41. This is the first report describing marked intrafamilial variation associated with Arg172Trp (R172W) peripherin/RDS mutation, including nonpenetrance. PMID: 16019073
  42. A three-generation family with an autosomal dominant pattern dystrophy arising from a previously unreported splice site mutation in the RDS gene is described. PMID: 16340530
  43. Age of onset, progression of the disease, and characteristic fundus abnormalities share similarities to previous reports on families with central areolar choroidal dystrophy associated with peripherin/RDS gene mutations PMID: 16832026
  44. Although RDS and VMD2 are the only known genes with mutations contributing to adult-onset vitelliform macular dystropht, our series demonstrates that most patients have mutations in genes that have yet to be discovered. PMID: 16885924
  45. To our knowledge, we report the first complex mutation in the peripherin/RDS gene as the cause of a mild macular phenotype, supporting the importance of molecular diagnosis in genetic counseling. PMID: 17031298
  46. The two siblings underwent genetic testing and were found to be carriers of a heterozygous frame-shift mutation 920delT affecting codon 307 of the peripherin/RDS gene PMID: 17148040
  47. mutations in the RDS/peripherin gene cause choroidal neovascularization in patients with adult-onset foveomacular dystrophy PMID: 17249552
  48. RDS gene is unlikely to be involved in the pathogenesis of age-related macular degeneration. PMID: 17362467
  49. Mutations in the peripherin/RDS gene are the major cause of multifocal pattern dystrophy simulating STGD1/fundus flavimaculatus. PMID: 17504850
  50. Different macular dystrophy phenotypes according to the mutations in peripherin/RDS. Limited phenotype variation was observed for these mutations within the family. PMID: 17653047

Show More

Hide All

Involvement in disease
Retinitis pigmentosa 7 (RP7); Retinitis punctata albescens (RPA); Macular dystrophy, vitelliform, 3 (VMD3); Macular dystrophy, patterned, 1 (MDPT1); Choroidal dystrophy, central areolar 2 (CACD2)
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment. Photoreceptor inner segment.
Protein Families
PRPH2/ROM1 family
Tissue Specificity
Retina (photoreceptor). In rim region of ROS (rod outer segment) disks.
Database Links

HGNC: 9942

OMIM: 136880

KEGG: hsa:5961

STRING: 9606.ENSP00000230381

UniGene: Hs.654489

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1