Recombinant Human Proline-rich transmembrane protein 2 (PRRT2)

Code CSB-CF018805HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
PRRT2
Uniprot No.
Alternative Names
PRRT2; Proline-rich transmembrane protein 2; Dispanin subfamily B member 3; DSPB3
Species
Homo sapiens (Human)
Expression Region
1-340
Target Protein Sequence
MAASSSEISEMKGVEESPKVPGEGPGHSEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVD SGPKAGLAPETTETPAGASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATA DQGSRLESAAPPEPAPEPAPQPDPRPDSQPTPKPALQPELPTQEDPTPEILSESVGEKQE NGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPR GSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMSRNSLQQ GDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
As a component of the outer core of AMPAR complex, may be involved in synaptic transmission in the central nervous system. In hippocampal neurons, in presynaptic terminals, plays an important role in the final steps of neurotransmitter release, possibly by regulating Ca(2+)-sensing. In the cerebellum, may inhibit SNARE complex formation and downregulate short-term facilitation.
Gene References into Functions
  1. This study showed that there is no significant difference in the the age at onset between the PKD patients with (n = 27) and without (n = 46) PRRT2 mutation. PMID: 29285950
  2. miR-30b promotes glioblastoma cell proliferation, migration, and invasion via targeting PRRT2. PMID: 28550683
  3. Results identified PRRT2 and DAB2IP to be frequently mutated in all different cancer cell line types. Further analysis showed that both genes were also frequently mutated in colorectal and endometrial cancer patient samples. Functional studies revealed PRRT2 to be implicated in cellular proliferation and migration with the truncated microsatellite instability-derived PRRT2 form promoting both processes. PMID: 27907910
  4. the expression level of PRRT2 was much higher in the human brain than in other human tissues, thus providing experimental evidence for a potential relationship between PRRT2 and neurogenesis. To the best of our knowledge, this study is the first to report the expression pattern of PRRT2 in human tissues. PMID: 27449084
  5. PRRT2 mutations have roles in neuronal dysfunction and neurodevelopmental defects PMID: 27172900
  6. The cases reported here constitute the first genetic-confirmed series of paroxysmal kinesigenic dyskinesia (PKD) in Hong Kong. The PRRT2 c.649dupC screening is recommened for all patients with all forms of PKD. PMID: 27920401
  7. Data show that proline-rich transmembrane protein 2 (PRRT2) is decreased in glioma and is targeted by microRNA miR-30a-5p. PMID: 28192116
  8. These findings indicate a novel role for zinc regulation in the PKCalpha/beta-catenin pathway and explain an important mechanism for controlling of stem cell program in lung cancer cells. PMID: 28122729
  9. PRRT2 mutations most likely not associated with benign epilepsy with centrotemporal spikes in Chinese mainland population. PMID: 26954261
  10. Exome sequencing was conducted and a duplication mutation c.649dupC (p.R217Pfs*8) in the proline-rich transmembrane protein 2 gene (PRRT2) was identified in patients with febrile seizures. PMID: 25502464
  11. In this study, 20 probands with BPEI were negative for family history of BPEI and negative for PRRT2 mutation. PMID: 26561923
  12. we found three new mutations in PRTTS in patients with Paroxysmal Kinesigenic Dyskinesia: c.insT27 p.Ser9*, c.G967A p.Gly323Arg and c.delCA215_216 p.Thr72Argfs*62. PMID: 26384010
  13. a novel intronic PRRT2 mutation causes paroxysmal kinesigenic dyskinesia with infantile convulsions PMID: 26936445
  14. comprehensive review of PRRT2-associated diseases. PMID: 26598493
  15. study highlights the frequency, novel mutations and clinical and molecular spectrum of PRRT2, SLC2A1 and PNKD mutations as well as the phenotype-genotype overlap among these paroxysmal movement disorders. PMID: 26598494
  16. 649dupC frameshift mutation of the PRRT2 gene is associated paroxysmal kinesigenic dyskinesia. PMID: 26829736
  17. mutant PRRT2, probably through its weakened interaction with SNAP25, affects glutamate signaling and glutamate receptor activity, resulting in the increase of glutamate release and subsequent neuronal hyperexcitability. PMID: 25915028
  18. PRRT2 mutations are common in patients with paroxysmal kinesigenic dyskinesia (PKD) and are associated with an earlier age at onset, longer duration of attacks, combined phenotypes of dystonia and chorea, and a tendency for a family history of PKD. PMID: 26446061
  19. investigated sequences of PRRT2 and CLCN1 in a proband diagnosed with paroxysmal kinesigenic dyskinesia and suspected myotonia congenita; the proband and his father harbored a PRRT2 c.649dupC mutation, and CLCN1 c.1723C>T and c.2492A>G mutations; first report showing the coexistence of PRRT2 and CLCN1 mutations PMID: 25205014
  20. phenotypic spectrum of biallelic mutations PMID: 25595153
  21. The results of this study suggest that the NMD of truncated mutation of PRRT2 and altered cellular localization of undegraded of PRRT2, might lead to Paroxysmal Kinesigenic. PMID: 25457817
  22. PRRT2 variants were probably involved in the etiology of febrile seizures in epileptic patients. PMID: 25522171
  23. A novel PRRT2 mutation was found in patients with benign familial infantile seizures. PMID: 25060993
  24. we describe the wide clinical spectrum associated with PRRT2 mutations and present the current hypotheses on the underlying pathophysiology [review] PMID: 25194488
  25. PRRT2 is the causative gene of infantile convulsions with paroxysmal choreoathetosis and the mutation c.649_650insC was the hotspot of PRRT2 mutations. PMID: 25449067
  26. Data indicate proline-rich transmembrane protein 2 (PRRT2) as the causative gene of paroxysmal kinesigenic dyskinesias, benign familial infantile seizures, convulsions with choreoathetosis, and suggest to name them as PRRT2-related paroxysmal disorders. PMID: 25297589
  27. Two novel mutations in PRRT2 were revealed in paroxysmal dyskinesia and choreoathetosis syndrome. PMID: 24609974
  28. results do not support a role for PRRT2 coding sequence variants in ASD, but provide an ascertainment of its genetic variability in worldwide populations that should help researchers and clinicians to better investigate the role of PRRT2 in human diseases PMID: 24594579
  29. This study indicated that positivity for PRRT2 mutation is a predictor of younger age of onset and more frequent of attacks in PKD patients. PMID: 24661410
  30. Our findings demonstrated that the c.186-187delGC mutation resulted in a truncated protein from the PRRT2 gene to involve in paroxysmal kinesigenic dyskinesia pathogenesis with haploinsufficiency PMID: 25027704
  31. This study confirms that PRRT2 mutations are common in paroxysmal kinesigenic dyskinesia with the first double PRRT2 mutation reported PMID: 23551744
  32. PRRT2 is a common causative gene for patients with paroxysmal kinesigenic dyskinesia from Southwest China. PMID: 23496026
  33. PRRT2 is the major causative gene of benign familial infantile epilepsy and infantile convulsions with paroxysmal choreoathetosis in Chinese families. PMID: 24370076
  34. In this family, benign familial infantile seizures (BFIS) are caused by a PRRT2 mutation and hemiplegic migraine by p.Arg689Gln ATPase ATP1A2 mutation. PMID: 24928127
  35. Compared to controls, patients with the p.P217fsX7 mutation showed increased amplitude of low-frequency fluctuation in the right postcentral gyrus. This might reflect the distinct pathological mechanism resulting from PRRT2 mutation PMID: 23532549
  36. mutation analysis of PRRT2 has identified c.649-650insC mutation in all BFIS patients. PMID: 23896529
  37. we identified PRRT2as the main causative gene for paroxysmal kinesigenic dyskinesia among the Taiwanese population PMID: 23436308
  38. PRRT2 mutations do not seem to be involved in the aetiology of FS or infantile epileptic encephalopathies. PMID: 24101679
  39. We describe a family with characteristic Paroxysmal dyskinesia and a nonsense PRRT2 mutation PMID: 22902309
  40. Our study revealed that PRRT2 mutations are common in Japanese patients with benign infantile epilepsy, especially in patients with a family history of paroxysmal kinesigenic dyskinesia PMID: 23131349
  41. Each rare copy number variation (CNV) is unique to one specific patient, except the PRRT2-containing 16p11.2 microduplication, illustrating the high level of genomic heterogeneity in rolandic epilepsy. PMID: 24372385
  42. This study further supports the idea that PRRT2 is the main causative gene for parkinson disease in Chinese people PMID: 23456995
  43. The identification of heterozygous mutations in the PRRT2 gene in paroxysmal kinesigenic dyskinesia as well as in benign familial infantile seizures linked episodic movement disorders with epilepsy. PMID: 23963607
  44. In this review, a description of numerous paroxysmal disorders and their link to PRRT2 mutations is described. PMID: 23398397
  45. The coexistence of paroxysmal kinesigenic dyskinesia and hemiplegic migraine is reported in twins harboring a heterozygous mutation in PRRT2. PMID: 23182655
  46. This study showed that 5 variants in the PRRT2 gene in 20 paroxysmal kinesigenic dyskinesia pedigrees. PMID: 23529024
  47. This study showed that in one paroxysmal kinesigenic dyskinesia combined with infantile seizures family with mutations are exclusively found in two exons of the PRRT2 gene. PMID: 23299620
  48. Review on the role of PRRT2 in benign familial infantile epilepsy, infantile convulsions with choreoathetosis syndrome, and paroxysmal kinesigenic dyskinesia. PMID: 23343561
  49. study enlarges the clinical spectrum related to PPRT2 mutations and underscores the complexity of the phenotypic consequences of mutations in this gene PMID: 23352743
  50. The results confirm that a mutation of PRRT2,is a hotspot mutation resulting in benign infantile epilepsy or infantile convulsions with choreoathetosis syndrome regardless of the ethnic background. PMID: 23073245

Show More

Hide All

Involvement in disease
Episodic kinesigenic dyskinesia 1 (EKD1); Convulsions, familial infantile, with paroxysmal choreoathetosis (ICCA); Seizures, benign familial infantile, 2 (BFIS2)
Subcellular Location
Cell membrane; Single-pass membrane protein. Cell junction, synapse, presynaptic cell membrane; Single-pass membrane protein. Cell junction, synapse. Cell projection, axon. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Cell junction, synapse, postsynaptic density membrane. Cell projection, dendritic spine.
Protein Families
CD225/Dispanin family
Database Links

HGNC: 30500

OMIM: 128200

KEGG: hsa:112476

STRING: 9606.ENSP00000351608

UniGene: Hs.655071

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1