Recombinant Human Small conductance calcium-activated potassium channel protein 2(KCNN2)

Code CSB-CF880957HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9H2S1
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVS SSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYK LGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTII LLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTAR LAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRF VMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIG YGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVK NAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLV DLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFI EAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS
Source in vitro E.coli expression system
Gene Names KCNN2
Protein Names Recommended name: Small conductance calcium-activated potassium channel protein 2 Short name= SK2 Short name= SKCa 2 Short name= SKCa2 Alternative name(s): KCa2.2
Expression Region 1-579
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Potassium channel KCNN family, KCa2.2/KCNN2 subfamily
Tissue Specificity Expressed in atrial myocytes (at protein level). Widely expressed.
Database Links

HGNC: 6291

OMIM: 605879

KEGG: hsa:3781

STRING: 9606.ENSP00000264773

UniGene: Hs.582520

Q&A and Customer Reviews

Q&A
Q:

Have you expressed your cell-free KCNN2 Recombinant Protein before (cat#: CSB-CF880957HU)? If yes, what was the MW of the protein? What is the tag info? Lead Time?

A:
Thanks for your inquiry. Sorry, for the time being, we haven't expressed this protein.
Recombinant Human Small conductance calcium-activated potassium channel protein 2(KCNN2)
CSB-CF880957HU
Expression Region:1-579 aa; Full length.
Expression Region: Tag type will be determined during the manufacturing process.
Sequence:

MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVSSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS


The expected tag of this protein is N-terminal 10xHis-tagged, and the theoretical Mw of this fusion protein is 67.26 kDa.
Customer Reviews

Related Products

KCNN2 Proteins

KCNN2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.