Recombinant Human Syntaxin-2 (STX2)

Code CSB-CF022898HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
STX2; EPIM; STX2A; STX2B; STX2C; Syntaxin-2; Epimorphin
Species
Homo sapiens (Human)
Expression Region
1-288
Target Protein Sequence
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.
Gene References into Functions
  1. Munc134 mediates human neutrophil elastaseinduced airway mucin5AC hypersecretion by interacting with syntaxin2 PMID: 29767240
  2. TGF-beta, bFGF and epimorphin in the extracellular microenvironment cooperatively affect HSF behaviors under the control of a highly sulfated chondroitin sulfate PMID: 28209294
  3. The effects of HIV/HCV co-infection on hepatic fibrosis might be mediated in part by epimorphin (EPM). Strategies to limit the expression of EPM might represent a novel therapeutic approach to prevent the progression of hepatic fibrosis during HIV/HCV co-infection. PMID: 27362846
  4. Identify 3 loci associated with circulating tPA levels, the PLAT region, STXBP5, and STX2. Functional studies implicate a novel role for STXBP5 and STX2 in regulating tPA release. PMID: 24578379
  5. Epimorphin can revert ovarian cancer cells away from their mesenchymal phenotype and toward an epithelial phenotype. PMID: 24039787
  6. Genetic variation in STX2 is associated with von Willebrand factor:Ag levels in patients diagnosed with type 1 von Willebrand Disease. PMID: 22792389
  7. EPM, secreted by activated stellate cells within stroma, promotes invasion and metastasis of hepatocellular cancer cells by activating MMP-9 expression through the FAK-ERK pathway. PMID: 22045676
  8. Genetic variability in STXBP5 and STX2 affects both VWF concentration and activity in young individuals with premature arterial thrombosis. PMID: 21156930
  9. Munc18b binds to syntaxins 1A, 2, and 3 and regulates vesicle transport to the apical plasma membrane PMID: 12198139
  10. These findings suggest that epimorphin contributes to repair of pulmonary fibrosis in nonspecific interstitial pneumonia, perhaps partly by inducing expression of matrix metalloproteinase 2, which is an important proteolytic factor in lung remodeling. PMID: 15651999
  11. expression of SNAP-23 and syntaxin-2 on the extracellular surface of the platelet plasma membrane. PMID: 17485553
  12. Inadequate epimorphin elicits an abnormal differentiation response in keratinocytes, and indicate a causal function of the epimorphin signaling gradient for the establishment of differentiated epidermal structure in the skin. PMID: 18273050
  13. Homology with vesicle fusion mediator syntaxin-1a predicts determinants of epimorphin/syntaxin-2 function in mammary epithelial morphogenesis.( PMID: 19129200

Show More

Hide All

Subcellular Location
Membrane; Single-pass type IV membrane protein.
Protein Families
Syntaxin family
Database Links

HGNC: 3403

OMIM: 132350

KEGG: hsa:2054

STRING: 9606.ENSP00000376178

UniGene: Hs.437585

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1