Product Details

Target Names

UGT1A10

Uniprot No.

Alternative Names

UGT1A10; GNT1; UGT1; UDP-glucuronosyltransferase 1A10; UGT1A10; UDP-glucuronosyltransferase 1-10; UDPGT 1-10; UGT1*10; UGT1-10; UGT1.10; UDP-glucuronosyltransferase 1-J; UGT-1J; UGT1J

Species

Homo sapiens (Human)

Expression Region

26-530

Target Protein Sequence

GKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSLNCTVKTYSTSYTLED QNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKESSFDAV FLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKE RVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPV MPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGK IPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPM VMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHK DRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFK CCAYGYRKCLGKKGRVKKAHKSKTH

Protein Length

Full Length of Mature Protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol. Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, caderastan and zolarsatan, drugs which can inhibit the effect of angiotensin II.; Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.

Gene References into Functions

UGT1A10 exhibited somewhat higher BPA glucuronidation activity than UGT1A9, but it was lower than UGT2A1 and UGT2B15. 4. PMID: 25547628
In further studies with UGT1A10, mutant F93G exhibited increased glucuronidation rates of 16alpha-hydroxyestrone, but not estrone PMID: 26220143
A graphene nanocage with regulatable space for the assembly of a CYP1A2-UGT1A10 bienzyme complex has been constructed via a click reaction, and used to study drug sequential metabolism using an electrochemically-driven method. PMID: 25264962
DNA hypermethylation results in defective expression of UGT1A10 in the liver. PMID: 24239897
Suggest that extrahepatic UGT1A10 plays an important role in the metabolism and the bioactivation of the antitumor agent C-1305. PMID: 23160818
Triazoloacridinone and imidazoacridinone antitumor agents C-1305 and C-1311 are glucuronidated in human liver and intestine. PMID: 22659092
Data suggest that darexaban glucuronidation in jejunum microsomes is mainly catalyzed by UGT1A10; studies include kinetics of recombinant UGT proteins, liver microsomes, and jejunal microsomes (and UGT isoform-specific inhibitors/substrates). PMID: 22031623
role of Phenylalanine 93 in UGT1A10 PMID: 21846474
The results also indicated that UGT1A1, UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2B7 are the most important six UGT isoforms for metabolizing the three dihydroxyflavones and seven monohydroxyflavones. PMID: 20297805
it appears that residues within segment C of the N-terminal domain, mainly at positions 152 and 169, contribute to the higher glucuronidation rates of UGT1A10 PMID: 20089735
Data suggest that UGT1A10 is important in detoxification of the carcinogen NNAL and that polymorphisms in UGT1A10 promoter (and thus altered gene expression) may be important in susceptibility to hepatocellular carcinoma. PMID: 20007297
Data point to UGT1A10 as primary UGT isoform metabolizing psilocin (a hallucinogenic indole alkaloid) in small intestine; kinetic studies are included. PMID: 20007669
UGT1A8, 1A9, and 1A10 genes are differentially regulated through an initiator element in their 5'-flanking regions PMID: 12847094
the UGT1A10 gene has several low-frequency missense polymorphisms and that the codon 139 polymorphism is an independent risk factor for orolaryngeal carcinoma in blacks PMID: 12910533
gastrointestinally distributed UGT1A10 is important for detoxifying estrogens/phytoestrogens and aromatic acids with complementary activity by UGT1A7, -1A8, -1A3, and/or -1A1 evidently dependent upon phosphorylation PMID: 15117964
structure-function analysis of UGT1A10 and its glucuronidation of bioflavonoids PMID: 16019943
Analysis of recombinant UGTs from 1A family for their ability to glucuronidate p-nitrophenol & 4-methylumbelliferone revealed that UGT1A10 shows high activity toward phenols. Phe(90) & Phe(93) are directly involved in the catalytic activity of UGT1A10. PMID: 16475821
Results show UGT1A10 mRNA expression in primary hepatocytes by semi-quantitative RT-PCR. PMID: 17603215
UGT1A7, UGT1A8, and UGT1A9 were mainly responsible for formation of prunetin-5- O-glucuronide; UGT1A1, UGT1A8, and UGT1A10 were mainly responsible for formation of prunetin-4'- O-glucuronide; thermostability of microsomes was isoform- and organ-dependent PMID: 18052087
UDP-glucuronosyltransferase chemical detoxifying system requires regulated phosphorylation supported by protein kinase C PMID: 18556656
UDP-glucuronic acid binds to specific sites in this enzyme. PMID: 18570380
The binding motif residue phenylalanine-90 appears to be the most significant contributor to glucuronidation of UGT1A10 hydroxywarfarin substrates. Alanine mutation of this residue abolishes activity toward 6- and 7-hydroxywarfarin. PMID: 18725508
Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 17558305

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Single-pass membrane protein.

Protein Families

UDP-glycosyltransferase family

Tissue Specificity

Liver and colon. Isoform 1 and isoform 2 are expressed in colon, esophagus and small intestine; isoform 2 but not isoform 1 is expressed in liver or kidney.

Database Links

HGNC: 12531

OMIM: 191740

KEGG: hsa:54575

STRING: 9606.ENSP00000343838

UniGene: Hs.554822

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-CF862057HU
MSDS	MSDS Datasheet
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human UDP-glucuronosyltransferase 1-10 (UGT1A10)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage