Recombinant Human herpesvirus 6B Protein U22 (U22)

In Stock
Code CSB-CF889529HKA
Abbreviation Recombinant Human herpesvirus 6B protein U22
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
U22
Uniprot No.
Research Area
others
Alternative Names
U22; Protein U22
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Source
in vitro E.coli expression system
Expression Region
1-202aa
Target Protein Sequence
MVPQGWSLAWVSVLYVSVIPSLHIINNENSVFIGTHSETELRHWLIFVKMAQRSGTAWWRMASVPINAYFERDIAFLFNPRCVIETALGSKILCRYNKNIGVVFVDNDTTCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRKERRRFLPRYERFVYYCISVYLFAVAVFCSCWFALDPLFNMWA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human herpesvirus 6B Protein U22 is produced through an in vitro E.coli expression system. This full-length protein spans amino acids 1-202 and includes an N-terminal 10xHis-tag that helps with purification. The protein reaches purity levels above 85%, verified through SDS-PAGE analysis. It's designed for research use only, with no tested activity or specified endotoxin level.

Protein U22 from Human herpesvirus 6B appears to play a role in the viral lifecycle, though its specific functions remain largely unclear. Scientists study this protein to better understand virus-host interactions and the possible ways the virus persists and evades immune responses. Research on U22 seems crucial for grasping the biology of Human herpesvirus 6B and how it affects human health.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Because E. coli cell-free systems lack eukaryotic chaperones, disulfide isomerases, and post-translational modification machinery, proteins of viral origin—particularly those interacting with host cell membranes or requiring complex folding—often misfold or remain in partially denatured conformations. There is no evidence that U22 folds autonomously in such systems. Therefore, while the recombinant U22 protein is valuable as a linear epitope antigen for antibody generation, immunoassay calibration, and sequence-based biochemical studies, it is unlikely to possess native tertiary structure or authentic bioactivity. Functional or binding assays based on folded conformations should only be pursued after appropriate refolding validation (e.g., circular dichroism or binding recovery tests).

1. Antibody Development and Validation

The recombinant U22 protein is well-suited for use as an immunogen in producing monoclonal or polyclonal antibodies, as its high purity and full-length coverage provide multiple linear epitopes. These antibodies can then be validated using this same recombinant protein in ELISA, Western blot, and immunofluorescence assays. If the native folding state is later confirmed or restored, the same antibodies could also be tested for recognition of conformational epitopes in infected cell models.

2. Structural and Biochemical Characterization

The protein can be used for biochemical verification, such as molecular weight determination, purity assessment, and limited proteolysis, but structural or biophysical studies like circular dichroism or NMR should only be performed after refolding validation. Because in vitro E. coli–expressed viral proteins often aggregate or remain unfolded, results from such analyses should be interpreted cautiously. If properly refolded, these methods could indeed characterize the secondary structure and stability of U22.

3. Enzyme-Linked Immunosorbent Assays (ELISA)

This His-tagged U22 protein can be used as a capture antigen in ELISA assays to detect anti-U22 antibodies in experimental samples. Its linear epitopes make it well-suited for such applications, and oriented attachment via the His-tag improves consistency. However, it should be noted that such assays will primarily measure antibodies recognizing linear epitopes, not conformational ones, unless the recombinant protein is refolded to mimic its native state.

Final Recommendation & Action Plan

The E. coli cell-free–expressed recombinant HHV-6B U22 protein is unlikely to fold correctly or display its native tertiary structure, given the expression system’s lack of post-translational machinery. Consequently, this protein is not suitable for native protein-protein interaction or functional studies without prior refolding validation. It is, however, well-suited for antibody development, ELISA-based immunoassays, and basic biochemical verification, where linear epitope presentation is sufficient.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Host membrane; Multi-pass membrane protein.
Database Links

KEGG: vg:1497024

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*