Recombinant Human herpesvirus 6B Protein U22 (U22)

In Stock
Code CSB-CF889529HKA
Abbreviation Recombinant Human herpesvirus 6B protein U22
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
U22
Uniprot No.
Research Area
others
Alternative Names
U22; Protein U22
Species
Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)
Source
in vitro E.coli expression system
Expression Region
1-202aa
Target Protein Sequence
MVPQGWSLAWVSVLYVSVIPSLHIINNENSVFIGTHSETELRHWLIFVKMAQRSGTAWWRMASVPINAYFERDIAFLFNPRCVIETALGSKILCRYNKNIGVVFVDNDTTCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRKERRRFLPRYERFVYYCISVYLFAVAVFCSCWFALDPLFNMWA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human herpesvirus 6B Protein U22 is produced through an in vitro E.coli expression system. This full-length protein spans amino acids 1-202 and includes an N-terminal 10xHis-tag that helps with purification. The protein reaches purity levels above 85%, verified through SDS-PAGE analysis. It's designed for research use only, with no tested activity or specified endotoxin level.

Protein U22 from Human herpesvirus 6B appears to play a role in the viral lifecycle, though its specific functions remain largely unclear. Scientists study this protein to better understand virus-host interactions and the possible ways the virus persists and evades immune responses. Research on U22 seems crucial for grasping the biology of Human herpesvirus 6B and how it affects human health.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Viral Protein Interaction Studies

This recombinant HHV-6B U22 protein can work as bait or target protein in protein-protein interaction assays to find cellular or viral binding partners. The N-terminal His-tag makes it easier to attach the protein to nickel-coated surfaces for pull-down experiments with cell lysates or purified protein libraries. These studies might help reveal the molecular mechanisms by which U22 contributes to HHV-6B disease development and host cell manipulation.

2. Antibody Development and Validation

The full-length recombinant U22 protein offers an ideal antigen for creating monoclonal or polyclonal antibodies specific to HHV-6B U22. Researchers can use the purified protein for immunization protocols and antibody screening via ELISA using the His-tag for capture. They can then validate antibody specificity. These antibodies would likely become valuable research tools for studying U22 expression, where it localizes in cells, and how it functions in infected cells.

3. Structural and Biochemical Characterization

This recombinant protein allows for detailed biochemical analysis of U22 properties. This includes confirming molecular weight, assessing protein folding, and studying stability under different conditions. The high purity level makes it suitable for biophysical techniques such as circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation. These methods can characterize the protein's secondary structure and oligomerization state.

4. Enzyme-Linked Immunosorbent Assays (ELISA)

The His-tagged U22 protein can serve as a capture antigen in research-grade ELISA platforms to detect and measure anti-U22 antibodies in experimental samples. The tag enables oriented attachment to nickel-coated plates, which may improve assay sensitivity and reproducibility. This application would be particularly useful for studying immune responses to HHV-6B infection in research models or characterizing antibody responses in laboratory studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Host membrane; Multi-pass membrane protein.
Database Links

KEGG: vg:1497024

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*