Recombinant Mouse ATP-binding cassette sub-family B member 10, mitochondrial (Abcb10)

Code CSB-CF867481MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Abcb10
Uniprot No.
Alternative Names
Abcb10; ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein
Species
Mus musculus (Mouse)
Expression Region
83-715
Target Protein Sequence
AGPRAAHPLFARLQGAAATGVRDLGNDSQRRPAATGRSEVWKLLGLVRPERGRLSAAVGF LAVSSVITMSAPFFLGRIIDVIYTNPSEGYGDSLTRLCAVLTCVFLCGAAANGIRVYLMQ SSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAG AQASVGVGMMFFVSPSLATFVLSVVPPISVLAVIYGRYLRKLSKATQDSLAEATQLAEER IGNIRTIRAFGKEMTEVEKYTGRVDQLLQLAQKEALARAGFFGAAGLSGNLIVLSVLYKG GLLMGSAHMTVGELSSFLMYAFWVGLSIGGLSSFYSELMKGLGAGGRLWELLERQPRLPF NEGMVLDEKTFQGALEFRNVHFTYPARPEVSVFQDFSLSIPSGSVTALVGPSGSGKSTVV SLLLRLYDPNSGTVSLDGHDIRQLNPVWLRSKIGTVSQEPVLFSCSVAENIAYGADNLSS VTAQQVERAAEVANAAEFIRSFPQGFDTVVGEKGILLSGGQKQRIAIARALLKNPKILLL DEATSALDAENEHLVQEALDRLMEGRTVLIIAHRLSTIKNANFVAVLDHGKICEHGTHEE LLLKPNGLYRKLMNKQSFLSYNGAEQFLEPARA
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the export of an unknown physiological substrate from the mitochondrial matrix to the cytosol in an ATP-dependent manner. May also transport the heme analog Zn (II) mesoporphyrin (ZnMP) in an ATP dependent manner but can't export the heme precursor 5-aminolevulinic acid (ALA) from mitochondria. Plays a role in the early step of the heme biosynthetic process during insertion of iron into protoporphyrin IX (PPIX). In turn participates in hemoglobin synthesis and also protects against oxidative stress. In addition may be involved in mitochondrial unfolded protein response (UPRmt) signaling pathway, although ABCB10 probably does not participate in peptide export from mitochondria.
Gene References into Functions
  1. Study demonstrates a mechanism of ABCB10 regulation driven by NF-E2 related factor-2 (Nrf2). In summary, Nrf2 dysregulation and ABCB10 suppression could likely mediate endothelial oxidative/inflammatory stress and BBB disruption in diabetic subjects. PMID: 28572033
  2. ATP binding and hydrolysis properties of ABCB10 by using the 8-azido-ATP photolabeling technique, was characterized. PMID: 26053025
  3. A critical role for Abcb10 in heme biosynthesis. PMID: 24421385
  4. ABC-me deletion causes an increase in mitochondrial superoxide production and protein carbonylation in erythroid precursors. PMID: 22240895
  5. Ferrochelatase forms an oligomeric complex with Mfrn1 and Abcb10 to synergistically integrate mitochondrial iron importation and use for heme biosynthesis. PMID: 20427704
  6. Data show that the binding domain of Mfrn1-Abcb10 interaction maps to the N terminus of Mfrn1. PMID: 19805291

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, ABCB family, Mitochondrial peptide exporter (TC 3.A.1.212) subfamily
Tissue Specificity
Expressed at particularly high levels in fetal liver, and erythroid tissues of embryos and adults. Found also in adult bone marrow, liver and kidney, and at lower levels in heart, brain and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×