Recombinant Mouse Apolipoprotein C-I(Apoc1)

Code CSB-CF001930MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P34928
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
Research Area Cardiovascular
Source in vitro E.coli expression system
Gene Names Apoc1
Expression Region 27-88aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 12.5 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein (By similarity). Binds free fatty acids and reduces their intracellular esterification.
Subcellular Location Secreted
Protein Families Apolipoprotein C1 family
Tissue Specificity Adult and fetal liver.
Database Links

KEGG: mmu:11812

STRING: 10090.ENSMUSP00000045571

UniGene: Mm.182440

Pathway Cholesterol metabolism

Related Products

Apoc1 Proteins

Apoc1 Proteins for Mus musculus (Mouse)

Apoc1 ELISA Kit

Apoc1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.