Recombinant Mouse Apolipoprotein C-I(Apoc1)

Code CSB-CF001930MO
Size US$1235
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Apoc1
Uniprot No. P34928
Research Area Cardiovascular
Alternative Names Apoc1Apolipoprotein C-I; Apo-CI; ApoC-I; Apolipoprotein C1) [Cleaved into: Truncated apolipoprotein C-I]
Species Mus musculus (Mouse)
Source in vitro E.coli expression system
Expression Region 27-88aa
Target Protein Sequence APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 12.5 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein (By similarity). Binds free fatty acids and reduces their intracellular esterification.
Gene References into Functions
  1. APOC1 expression induces glomerulosclerosis, potentially by increasing the cytokine response in macrophages. PMID: 27976371
  2. Apolipoprotein C-I was significantly increased in obese mice plasma. PMID: 22404376
  3. The absence of ApoC-I results in impaired memory functions, which is, together with previous data, suggestive of an important, bell-shaped gene-dose dependent role for ApoC-I in appropriate brain functioning PMID: 21157034
  4. Data show that the stimulating effect of apoCI on the lipopolysaccharide (LPS)response resembles that of LPS-binding protein (LBP) and depends on CD14/ Toll-like receptor 4 signaling. PMID: 20335569
  5. regulated expression of gene cluster in macrophages PMID: 12032151
  6. present observations provide direct support for a potent specific inhibition of CETP by plasma apoCI in vivo PMID: 12070157
  7. The apoC-I content of lipoprotein remnants may serve as an early marker of coronary artery disease risk. PMID: 12231568
  8. TR4 can also regulate apolipoprotein E, C-I, and C-II gene expression via the TR4 response element within the hepatic control region PMID: 12954636
  9. apoC-I is a potent inhibitor of LPL-mediated triglyceride lipolysis PMID: 15576844
  10. irrespective of receptor-mediated remnant clearance by the liver, liver-specific expression of recombinant human apoCI causes hypertriglyceridemia in the absence of the VLDLr and apoCIII in mice PMID: 16478678
  11. Endogenous apoC-I increases hyperlipidemia in apoE-knockout mice by stimulating VLDL production and inhibiting LPL. PMID: 16537968
  12. Knockout mice show significant increases in the hepatic content of cholesteryl esters and triglycerides and in biliary cholesterol concentration. PMID: 17053273
  13. Systemic apoCI increases atherosclerosis, probably by inducing hyperlipidemia, in the absence of ApoE PMID: 17320883
  14. Data suggest that apoC-I binds free fatty acids (FFA), thereby reducing the blood FFA for uptake by cells, and this mechanism can serve as an additional mechanism for the resistance to obesity and the cutaneous abnormalities of APOC1(+/+) mice. PMID: 17339654
  15. apoCI is crucially involved in lipopolysaccharide(LPS)-induced atherosclerosis in apoe-/- mice, which mainly relates to an increased inflammatory response toward LPS PMID: 17967778
  16. apoCI is a novel inhibitor of the scavenger receptor BI -mediated uptake of HDL cholesterol by hepatocytes; apoCI is a determinant for the plasma levels and size of HDL in vivo. PMID: 18992221

Show More

Hide All

Subcellular Location Secreted
Protein Families Apolipoprotein C1 family
Tissue Specificity Adult and fetal liver.
Database Links

KEGG: mmu:11812

STRING: 10090.ENSMUSP00000045571

UniGene: Mm.182440

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1