Recombinant Mouse CAAX prenyl protease 2(Rce1)

Code CSB-CF019509MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P57791
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MAALGGDGLRLLSVSRPERQPESAALSGPGSGLCCWVSVFSCFSLACSYVGSLYVWKSEL PRDHPAVIKRRSTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL LLTMILFLGPLMQLSMDCPCDLTDGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR ACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGSIFVSAAFQFSYTAVF GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQKWPLLAGYALGVGLFLLLLQ PLTDPKLYGSLPLCMLLERTGASETLLCS
Source in vitro E.coli expression system
Gene Names Rce1
Protein Names Recommended name: CAAX prenyl protease 2 EC= 3.4.22.- Alternative name(s): Farnesylated proteins-converting enzyme 2 Short name= FACE-2 Prenyl protein-specific endoprotease 2 RCE1 homolog
Expression Region 1-329
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1 (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Peptidase U48 family
Database Links

KEGG: mmu:19671

STRING: 10090.ENSMUSP00000025823

UniGene: Mm.391143

Related Products

Rce1 Proteins

Rce1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.