Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-CF872883MO |
Size | Pls inquire |
Source | in vitro E.coli expression system |
Have Questions? | Leave a Message or Start an on-line Chat |
Target Names | Elovl1 |
Uniprot No. | Q9JLJ5 |
Alternative Names |
Elovl1; Ssc1; Elongation of very long chain fatty acids protein 1; 3-keto acyl-CoA synthase Elovl1; ELOVL fatty acid elongase 1; ELOVL FA elongase 1; Very long chain 3-ketoacyl-CoA synthase 1; Very long chain 3-oxoacyl-CoA synthase 1
|
Species | Mus musculus (Mouse) |
Expression Region | 1-279 |
Target Protein Sequence | MEAVVNLYHELMKHADPRIQSYPLMGSPLLITSILLTYVYFILSLGPRIMANRKPFQLRG FMIVYNFSLVILSLYIVYEFLMSGWLSTYTWRCDPIDFSNSPEALRMVRVAWLFMLSKVI ELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYL YYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYG TIFFILFSNFWYHSYTKGKRLPRAVQQNGAPATTKVKAN |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal His-tagged Tag-Free The tag type will be determined during production process. If
you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time
may differ from different purchasing way or location, please kindly consult your local distributors
for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that exhibits activity toward saturated and monounsaturated acyl-CoA substrates, with the highest activity towards C22:0 acyl-CoA. May participate in the production of both saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Important for saturated C24:0 and monounsaturated C24:1 sphingolipid synthesis. Indirectly inhibits RPE65 via production of VLCFAs.
|
Gene References into Functions |
|
Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. |
Protein Families | ELO family, ELOVL1 subfamily |
Tissue Specificity | Expressed in a broad variety of tissues. Highly expressed in stomach, lung, kidney, skin and intestine. Moderately expressed in white adipose tissue, liver, spleen, brain, brown adipose tissue, heart and muscle. Weakly expressed in testis. |
Database Links |
KEGG: mmu:54325 STRING: 10090.ENSMUSP00000006557 UniGene: Mm.282096 |