Recombinant Mouse Free fatty acid receptor 1 (Ffar1)

Code CSB-CF008604MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ffar1; Gpr40; Free fatty acid receptor 1; G-protein coupled receptor 40
Species
Mus musculus (Mouse)
Expression Region
1-300
Target Protein Sequence
MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLGCSDLLLAITLP LKAVEALASGAWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP RYSWGVCVAIWALVLCHLGLALGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDPDSAR PARLSFSILLFFLPLVITAFCYVGCLRALVRSGLSHKRKLRAAWVAGGALLTLLLCLGPY NASNVASFINPDLGGSWRKLGLITGAWSVVLNPLVTGYLGTGPGRGTICVTRTQRGTIQK
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for medium and long chain saturated and unsaturated fatty acids that plays an important role in glucose homeostasis. Fatty acid binding increases glucose-stimulated insulin secretion, and may also enhance the secretion of glucagon-like peptide 1 (GLP-1). May also play a role in bone homeostasis; receptor signaling activates pathways that inhibit osteoclast differentiation. Ligand binding leads to a conformation change that triggers signaling via G-proteins that activate phospholipase C, leading to an increase of the intracellular calcium concentration. Seems to act through a G(q) and G(i)-mediated pathway. Mediates the anti-inflammatory effects of omega-3 polyunsaturated fatty acids (PUFAs) via inhibition of NLRP3 inflammasome activation.
Gene References into Functions
  1. FFAR1 point mutation R258W abrogates fatty acid-induced insulin secretion PMID: 29031729
  2. We found that FFAR1-/- female mice showed significant impairments in maternal behavior, and exhibited an emotionally altered behavior, when compared to WT mice. Our findings suggest that the dysfunction of brain PUFA-GPR40/FFAR1 signaling might induce damage to emotional and maternal behavior in female mice. PMID: 28769007
  3. GPR40 and (GPR120) act in concert in the hypothalamus to reduce energy efficiency and regulate the inflammation associated with obesity. PMID: 28446241
  4. GPR40 role in the bone loss PMID: 27611773
  5. These findings suggested that dysfunction of the GPR40/FFAR1 signaling pathway altered the endogenous pain control system and that this dysfunction might be associated with the development of chronic pain. PMID: 28723961
  6. Together, our data indicate effects of AgoPAMs that go beyond glucose lowering previously observed with GPR40 partial agonist treatment with additional potential for weight loss. PMID: 28292762
  7. These results support the hypothesis that mercaptoacetate stimulates food intake by blocking fatty acid effects on GPR40. PMID: 26984894
  8. These results indicated that GPR120 enhanced and GPR40 inhibited the cell motile activity of highly migratory osteosarcoma cells. PMID: 28159555
  9. Results suggest that brain GPR40/FFAR1 is associated with anxiety- and depression-related behavior regulated by the increment of noradrenaline in the brain. PMID: 27979701
  10. Data revealed a weak influence of GPR40 agonist on osteoblast markers expression. Nevertheless, a significant increase in OPG expression was observed upon GW9508 treatment that contribute to explain the GPR40-related osteoporosis prevention PMID: 26699911
  11. In the retinas of Vldlr(-/-) mice with low fatty acid uptake but high circulating lipid levels, we found that Ffar1 suppresses expression of the glucose transporter Glut1 PMID: 26974308
  12. activation of the hypothalamic GPR40/FFA1 signaling pathway may regulate beta-endorphin release via PC2, and regulate the endogenous pain control system PMID: 26071852
  13. These results suggest that both PPARgamma and GRP40 are required for RSG-induced inhibition of mouse calvaria osteoblast differentiation, which is mediated through GSK3beta-dependent pathway. PMID: 26116229
  14. GPR40 signaling pathway plays an important suppressive role in spinal nociceptive processing after inflammation or nerve injury PMID: 25889021
  15. GPR40/FFAR1 indirectly modulates organ-specific effects of CLAs. PMID: 25895678
  16. knocking down the expression of the regulatory subunit PKAR1alpha, thereby reproducing the effects of IL-1beta and PGE on VSMCs, we demonstrated the contribution of PKA activity to the observed behavior of VSMCs PMID: 26408932
  17. results demonstrate that GPR40 deficiency leads to an extended osteoarthritis phenotype PMID: 25585625
  18. No effects of BCAO were noted on hypothalamic GPR40 protein expression. PMID: 25281202
  19. Intense GPR40 mRNA expression was shown by in situ hybridization in mouse hippocampal and motor cortex neurons. A selective agonist produced the phosphorylation of CREB and of ERK1/2. PMID: 24550142
  20. Brain GPR40 signaling may regulate depression-related behavior. PMID: 24758921
  21. Hypothalamic GPR40 signaling activated by free long chain fatty acids suppresses inflammatory chronic pain. PMID: 24349089
  22. results suggest that palmitic acid induces superoxide production and potentiates glucose-stimulated insulin secretion through NADPH oxidase and GPR40 pathways in pancreatic cells. PMID: 23817296
  23. Potent free fatty acid 1 receptor agonist TUG-469 may be promising candidate for the treatment of type 2 diabetes mellitus. PMID: 23861168
  24. Silencing FFAR1 expression reduced the PIO-mediated increases in the expression of above proteins. PMID: 24360748
  25. Our findings indicate that loss of GPR40/FFAR1 function does not play an important role in inducing or exacerbating diabetes. PMID: 23331570
  26. Allosterism at FFA1 can contribute to postprandial glucose management by stimulating insulin secretion via an extrapancreatic mechanism of action. PMID: 23403053
  27. In vitro, in GPR40-expressing human embryonic kidney (HEK)-293 cells, [(14)C]-14E-AA (radiolabeled TAA) bound specifically, and TAA induced calcium transients, extracellular signal-regulated kinase 1/2 phosphorylation PMID: 23520164
  28. The free fatty acid receptor G protein-coupled receptor 40 (GPR40) protects from bone loss through inhibition of osteoclast differentiation PMID: 23335512
  29. G protein-coupled receptor (GPR)40-dependent potentiation of insulin secretion in mouse islets is mediated by protein kinase D1. PMID: 22820510
  30. Data indicate that thiazolidinediones (TZDs) rapidly activated Erk1/2 and p38 through G protein-coupled receptor 40 (GPR40), a receptor expressed on the surface of osteocytes. PMID: 22593579
  31. Antinociception via beta-endorphin release is mediated through GPR40 signaling in the supraspinal area and provides valuable information on a novel therapeutic approach for pain control. PMID: 22137657
  32. Long-chain fatty acid receptor GPR40 induces secretion of cholecystokinin by duodenal I cells in response to dietary fat. PMID: 20955703
  33. These results indicate that GPR40 mediates the short-term effects of free fatty acids on glucose-stimulated insulin secretion, but does not mediate the chronic lipotoxicity on beta-cells. PMID: 21036144
  34. GPR40 is integral to the antidiabetic effects of Adrb3 agonists. PMID: 20416356
  35. GPR40 is expressed in the taste buds, mainly in type i cells. GPR40 knockout mice show a diminished preference for linoleic acid and oleic acid. PMID: 20573884
  36. The results demonstrate that GPR40 is indeed necessary, at least in part, for fatty-acid-stimulated insulin release. PMID: 16044321
  37. GPR40 plays an important role in the chain of events linking obesity and type 2 diabetes. PMID: 16054069
  38. GPR40 has the capacity to respond to fatty acids with chain lengths of four or greater. PMID: 16267104
  39. This study demonstrates that GPR40 is present and active in pancreatic alpha-cells and puts further emphasis on the importance of this nutrient sensing receptor in islet function. PMID: 17214971
  40. GPR40 contributes approximately half of the full acute insulin secretory response to fatty acids in mice but does not play a role in the mechanisms by which fatty acids chronically impair insulin secretion. PMID: 17395749
  41. cell-specific expression of the GPR40 gene involves a characteristic chromatin organization of the locus and is controlled at the transcriptional level through HR2, a potent beta cell-specific enhancer PMID: 17525159
  42. Might be implicated in the control of pancreatic beta-cell mass plasticity; may provide a link between obesity and type 2 diabetes. PMID: 17556534
  43. Gpr40 modulates FFA-stimulated insulin secretion from beta-cells not only directly but also indirectly via regulation of incretin secretion PMID: 18519800
  44. GPR40 plays a role not only in fatty acid modulation of insulin secretion, but also in glucose induced insulin secretion after high-fat feeding PMID: 18559658
  45. FFAR1 is required for normal insulin secretion in response to fatty acids; however, Ffar1(-/-) mice are not protected from high-fat diet-induced insulin resistance or hepatic steatosis. PMID: 18678612
  46. Deletion of GPR40 impairs insulin secretion in vivo in response to fatty acids and also to glucose and arginine, without altering intracellular fuel metabolism in islets. PMID: 19720802

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in pancreatic islet beta cells (at protein level). Expressed in pancreatic islet beta cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1