Recombinant Mouse Ghrelin O-acyltransferase (Mboat4)

Code CSB-CF013548MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Mboat4
Uniprot No.
Alternative Names
Mboat4; Gm171; Goat; Ghrelin O-acyltransferase; Membrane-bound O-acyltransferase domain-containing protein 4; O-acyltransferase domain-containing protein 4
Species
Mus musculus (Mouse)
Expression Region
1-435
Target Protein Sequence
MDWLQLFFLHPLSFYQGAAFPFALLFNYLCILDTFSTRARYLFLLAGGGVLAFAAMGPYS LLIFIPALCAVALVSFLSPQEVHRLTFFFQMGWQTLCHLGLHYTEYYLGEPPPVRFYITL SSLMLLTQRVTSLSLDICEGKVEAPRRGIRSKSSFSEHLWDALPHFSYLLFFPALLGGSL CSFRRFQACVQRSSSLYPSISFRALTWRGLQILGLECLKVALRSAVSAGAGLDDCQRLEC IYLMWSTAWLFKLTYYSHWILDDSLLHAAGFGAEAGQGPGEEGYVPDVDIWTLETTHRIS LFARQWNRSTALWLRRLVFRKSRRWPLLQTFAFSAWWHGLHPGQVFGFLCWSVMVKADYL IHTFANVCIRSWPLRLLYRALTWAHTQLIIAYIMLAVEGRSLSSLCQLCCSYNSLFPVMY GLLLFLLAERKDKRN
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the octanoylation of ghrelin at 'Ser-3'. Can use a variety of fatty acids as substrates including octanoic acid, decanoic acid and tetradecanoic acid.
Gene References into Functions
  1. the effect of GOAT on gastric acid secretion and expression of ghrelin in vitro, were investigated. PMID: 29966658
  2. GOAT immunoreactivity is aggregated at the base of the dentate granule cell layer in wild-type mice. This was not affected by the pharmacological inhibition of GHSR1a or the metabolic state-dependent fluctuation of systemic ghrelin levels. But it was absent in the GHSR1a knockout mouse hippocampus, implying that the expression of GHSR1a may be a prerequisite for the production of GOAT. PMID: 29063591
  3. Both ghrelin and GOAT are localized primarily in the red pulp of the spleen. Importantly, in the thymus, ghrelin was predominantly localized to the medulla, whereas GOAT was found in the cortex, implying differing roles in T cell development. Both regulates obesity-induced inflammation. PMID: 28368434
  4. anxiogenic actions of GOAT deletion not related to high plasma des-acyl ghrelin PMID: 27490185
  5. GOAT knock-out pregnant mice on calorie-restricted diet are more prone to hypoglycemia than wild type. PMID: 27701682
  6. circadian rhythmicity of ghrelin signaling requires Bmal1 and is driven by a food-responsive clock in the gastric ghrelin-secreting cell that not only regulates ghrelin, but also GOAT activity. PMID: 26576661
  7. observations demonstrate that germline loss of ghrelin-O-acyltransferase alters Growth Hormone release and patterning PMID: 26442444
  8. Altered lipid and salt taste responsivity in ghrelin and GOAT null mice. PMID: 24124572
  9. The absence of GOAT does not alter glucose intolerance suggesting that desacyl/acyl ghrelin is not a major denominator for glucose homeostasis. PMID: 23630616
  10. The absence of the enzyme GOAT does not play a significant role in maintenance of body core temperature or metabolic adaptation during exposure to low external temperatures. PMID: 22526011
  11. GOAT induced ghrelin acylation regulates hedonic feeding. PMID: 22982020
  12. The endogenous GOAT-ghrelin-growth hormone secretagogue receptor system is not essential for the maintenance of euglycemia during prolonged calorie restriction. PMID: 22363801
  13. While there is considerable overlap in expression pattern between ghrelin and ghrelin O-acyltransferase (GOAT), the latter exhibits some unique tissue expression that could suggest that additional peptides may be acylated and await discovery.(Review) PMID: 21600256
  14. This is the first report that the GOAT/ghrelin system regulates bile acid metabolism, and these findings suggest a novel function of GOAT in the regulation of intestinal bile acid reabsorption.. PMID: 21965605
  15. Ghrelin O-acyltransferase (GOAT) is essential for growth hormone-mediated survival of calorie-restricted mice PMID: 20231469
  16. The present study demonstrates that stomach GOAT mRNA levels correlate with circulating acylated-ghrelin levels in fasted and diet-induced obese mice. PMID: 20035826
  17. These data suggest species differences between rats and mice in gastric GOAT expression perhaps resulting in a different role of the MBOAT4 enzyme in the rat stomach. PMID: 20059966
  18. The presence of PC and GOAT in the cells, as well as n-octanoic acid in the culture medium, was necessary to produce n-octanoyl ghrelin. PMID: 19628676
  19. Study identifies GOAT (Ghrelin O-Acyltransferase), a polytopic membrane-bound enzyme that attaches octanoate to serine-3 of ghrelin; consistent with its function, GOAT mRNA is restricted to stomach and intestine, the ghrelin-secreting tissues. PMID: 18267071
  20. The identification and characterization of human GOAT, the ghrelin O-acyl transferase, is reported. PMID: 18443287
  21. GOAT is the only member of the MBOAT family whose expression is highly enriched within gastric ghrelin cells and whose whole body distribution mirrors that of ghrelin. PMID: 19401456
  22. GOAT mRNA was expressed in murine cartilage explants as well as in the cultured murine chondrogenic ATDC-5 cell line. PMID: 19479831
  23. a four-amino acid peptide derived from the N-terminal sequence of ghrelin can be modified by GOAT, indicating that these four amino acids constitute the core motif for substrate recognition by the enzyme. PMID: 19501572
  24. ghrelin-GOAT system as a signaling pathway that alerts the central nervous system to the presence of dietary calories, rather than to their absence as is commonly accepted. PMID: 19503064

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Membrane-bound acyltransferase family
Tissue Specificity
Highly expressed in stomach. Lower expression in small intestine and colon. Very low expression in testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1