Recombinant Mouse Lysophosphatidic acid receptor 2(Lpar2)

Code CSB-CF013048MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9JL06
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRF HQPIYYLLGNLAAADLFAGMAYLFLMFHTGPPHCQALHQRLVPATGPAGHQPHGVSGHTA GIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVP LFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTV VIILGAFVVCWTPGQVVLLLDGLDCKTCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMR RTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL
Source in vitro E.coli expression system
Gene Names Lpar2
Protein Names Recommended name: Lysophosphatidic acid receptor 2 Short name= LPA receptor 2 Short name= LPA-2 Alternative name(s): Lysophosphatidic acid receptor Edg-4
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Plays a key role in phospholipase C-beta (PLC-beta) signaling pathway Stimulates phospholipase C (PLC) activity in a manner that is independent of RALA activation (By similarity).
Subcellular Location Cell surface, Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Most abundantly expressed in testes, kidney, and embryonic brain. Other organs also express the transcript, including heart, lung, spleen, thymus, stomach, and adult brain. Several have little or no expression, including liver, small intestine, and skelet
Database Links

UniGene: Mm.23253

Pathway PI3K-Akt signaling pathway
Oxidative Phosphorylation
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

Lpar2 Proteins

Lpar2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.