Recombinant Mouse PRA1 family protein 3 (Arl6ip5)

Code CSB-CF844467MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Arl6ip5
Uniprot No.
Alternative Names
Arl6ip5; Aip5; Jwa; Pra2; Praf3; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5; Addicsin; GTRAP3-18; Glutamate transporter EAAC1-interacting protein; Prenylated Rab acceptor protein 2; Protein JWa
Species
Mus musculus (Mouse)
Expression Region
1-188
Target Protein Sequence
MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGVIVVLVFMGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVM VFVFGITLPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDNINKFA DYISKARE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate in a PKC activity-dependent manner. Plays a role in the retention of SLC1A1/EAAC1 in the endoplasmic reticulum.
Gene References into Functions
  1. Glutamate transporter-associated protein 3-18 (GTRAP3-18), an anchor protein that retains interacting proteins in the endoplasmic reticulum, is a critical regulator of food intake and body weight by interacting with POMC. GTRAP3-18-deficient mice showed hypophagia, lean bodies, and lower blood glucose, insulin, and leptin levels with increased serum and brain alpha-MSH levels, leading to AMPK inhibition. PMID: 28904020
  2. Protective effect of JWA against paraquat neurotoxicity involves regulation of the MEK/PI3K-Nrf2 axis. PMID: 28428137
  3. the JWA deficiency through cascading FAK-PI3K-Akt-mTOR pathway increases the newborn neurons. PMID: 25432888
  4. Arl6ip5 is a novel regulator of bone formation in osteoblasts. PMID: 25321471
  5. This study provided evidence that astrocytic JWA expression protects DA neurons from degeneration and plays an important role in neuroprotection via inhibition of ROS and NF-kappaB activation. PMID: 24628733
  6. The double-fluorescent immunohistochemical analysis revealed that addicsin and TR1 were coexpressed in neurons PMID: 24680664
  7. Data show the importance of JWA (Arl6ip5) in skin homeostasis and in the process of skin tumor development. PMID: 22461904
  8. This study demonistrated that GTRAP3-18(-/-) mice performed better in motor/spatial learning and memory tests. The suppression of GTRAP3-18 increases neuronal resistance to oxidative stress by increasing GSH content and also facilitates cognitive function PMID: 22210510
  9. Arl6ip1 is a novel addicsin-associated partner that promotes EAAC1-mediated glutamate transport activity by decreasing the number of addicsin molecules available for interaction with EAAC1. PMID: 18684713
  10. 98% identity with that of rat GTRAP3-18; upregulated in the amygdala by repeated administration of morphine PMID: 12438930
  11. Addicsin mRNA is expressed in CNS neurons and may participate in the functional expression of the somatic sensory system by modulation of EAAC1-mediated glutamate transport. PMID: 16005150
  12. Our studies demonstrated that H(2)O(2) is the primary oxidative product responsible for benzo[a]pyrene (B[a]P)-induced JWA expression, and knockdown of JWA elevates H(2)O(2) (100 microM)- and B[a]P (100 microM)-induced DNA damage. PMID: 17462538
  13. inhibits EAAT3-mediated glutamate uptake; highly conserved protein and genomic organization amongst vertebrates PMID: 12119102

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.
Protein Families
PRA1 family
Tissue Specificity
Expressed in the cerebral cortex, cerebellum, hippocampus, olfactory bulbs, medulla oblongate and limbic system (at protein level). Ubiquitous.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1