Recombinant Mouse Platelet-activating factor receptor(Ptafr)

Code CSB-CF018946MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q62035
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MEHNGSFRVDSEFRYTLFPIVYSVIFILGVVANGYVLWVFANLYPSKKLNEIKIFMVNLT MADLLFLITLPLWIVYYYNEGDWILPNFLCNVAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPY SVPILVVHVFIAFCFFLVFFLIFYCNLVIIHTLLTQPMRQQRKAGVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVIVPANQTPIVSLKN
Source in vitro E.coli expression system
Gene Names Ptafr
Protein Names Recommended name: Platelet-activating factor receptor Short name= PAF-R Short name= PAFr
Expression Region 1-341
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Found in a range of organs. Expressed most strongly in spleen, followed by skeletal muscle, lung and small intestine. Expressed at moderate levels in the heart. Expressed at relatively low levels in the brain, liver and kidney.
Database Links

KEGG: mmu:19204

STRING: 10090.ENSMUSP00000070925

UniGene: Mm.459220

Pathway Calcium signaling pathway

Related Products

Ptafr Proteins

Ptafr Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.