Recombinant Mouse Relaxin receptor 2 (Rxfp2)

Code CSB-CF852824MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Rxfp2; Gpr106; Great; Lgr8; Relaxin receptor 2; G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; Leucine-rich repeat-containing G-protein coupled receptor 8; Relaxin family peptide receptor 2
Species
Mus musculus (Mouse)
Expression Region
1-737
Target Protein Sequence
MWLLLHVILLTEVKDFALADSSMVAPLCPKGYFPCGNLTKCLPRAFHCDGVDDCGNGADE DNCGDTSGWTTIFGTVHGNVNKVTLTQECFLSQYPQHCYCRENELECVKADLKAVPKVSS NVTLLSLKKNKIHRLPVKVFSRYTELRKIYLQHNCITHISRRAFLGLHNLQILYLSHNCI TSLRPGIFKDLHQLAWLILDDNPITRISQKSFMGLNSLFFLSMVGNRLEALPETLCAQMP QLNWVDLANNGIKYITNSTFLTCDSLTVLFLPRNQIGFVPEKTFSSLKNLGELDLSSNMI TKLPVHLFSDLHLLQKLNLSSNPLLYVHKNQFGSLKQLQSLDLERIEIPNISTGMFQPMK NLSHIYLKTFRYCSYVPHVRICMPSTDGISSSEDLLANGILRVSVWVIAFITCVGNFLVI AVRSLIKAENTTHAMSIKILCCADCLMGVYLFSVGVFDIKYRGQYQKYALLWMESVPCRL LGFLATLSTEVSVLLLTFLTLEKFLVIVFPFSNLRLGKRQTAVALASIWVVGFLIAAVPF TREDYFGNFYGKNGVCFPLHYDQAEDFGSRGYSLGIFLGVNLLAFLVIVISYVTMFCSIH KTALQTAEVRSHIGKEVAVANRFFFIVFSDAICWIPVFVVKILSLLQVEIPGTITSWIVV FFLPVNSALNPILYTLTTSFFKDKLKQLLHKHRRKPIFKVKKKSLSASIVWTDESSLKLG VLSKIALGDSIMKPVSP
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for relaxin. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3).
Gene References into Functions
  1. Loss of function of Lgr6 did not impact epidermal cell proliferation, cell migration and wound healing. PMID: 27579888
  2. Results suggest that DES causes testicular maldescent by altering the LGR8 pathway in mouse gubernaculum testis cells. PMID: 26855023
  3. The results displayed that INSL3 changed RXFP2 expression in mouse gubernaculum testis cells in vitro PMID: 26823808
  4. data suggest a novel role for Rln in craniofacial skeletal development and metabolism through Rxfp2 PMID: 24857857
  5. Rxfp1, Rxfp2, and Nr3c1 mRNAs were expressed on the developing maxilla and mandible, Meckel's cartilage, tongue, and tooth primordia between mouse embryonic days 13.5-18.5. PMID: 24370181
  6. Spermatogonial stem cells undergo drastic depletion in the cryptorchid testes of RXFP2 deficient mice. PMID: 24098584
  7. Data suggest that Insl3/Rxfp2 (insulin-like peptide 3/relaxin receptor 2) signaling is important for testicular descent; however, germ-cell deletion of Rxfp2 did not affect spermatogenesis, germ cell survival, or male fertility. PMID: 23100620
  8. Prenatal exposure to diethylstilbestrol increased the expression of LGR8 mRNA in the mouse gubernaculum testis. PMID: 22934511
  9. A deficiency for Rxfp2 on Cav1-deficient background led to more than a 2-fold increase in the incidence of uterine cysts. PMID: 21467199
  10. A mouse model was created containing a novel missense mutation in Relaxin/insulin-like family peptide receptor 2 which likely prevents binding to its ligand, Insulin-like peptide 3, resulting in failure of the transabdominal phase of testicular descent. PMID: 20963592
  11. RXFP2 signaling pathway plays an important role in mediating androgen action to stimulate gubernaculum development during inguinoscrotal testis descent. PMID: 20154177
  12. Insulin-like 3 peptide or great cause cryptorchidism (undescended testes) in mice. PMID: 12933905
  13. Disruption of the Greatgene causes failure of the transabdominal phase of descent, identical to that seen in the Insl3-deficient mutants, consistent with the recent data suggesting that Great gene encodes the Insl3 transmembrane receptor. PMID: 14666470
  14. neither Insl3 nor Lgr8 contribute to the RLN signaling pathway; Insl3/Lgr8 and Rln1/Lgr7 actions do not overlap in vivo PMID: 15256493
  15. Rxfp2 gene expression at different stages of embryonic and postnatal mouse development in male reproductive tissues was examined PMID: 17615407
  16. Rxfp2-deficient mice showed decreased bone mass, mineralizing surface, bone formation, and osteoclast surface. PMID: 19416191
  17. The data suggest that Pod1 may negatively regulate Rxfp2 expression in the developing glomerulus to promote cell proliferation. PMID: 19416211

Show More

Hide All

Involvement in disease
Defects in Rxfp2 seems to be a cause of impaired testicular descent (known as cryptorchidism).
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in embryonic and adult gonads of males and females, as well in male gubernarculum. Expressed also in brain. Not detected in kidney, spleen and heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1