Product Details

Target Names

Ugt1a6

Uniprot No.

Alternative Names

Ugt1a6; Ugt1; Ugt1a6a; Ugt1a7; UDP-glucuronosyltransferase 1-6; UDPGT 1-6; UGT1*6; UGT1-06; UGT1.6; Phenol UDP-glucuronosyltransferase; UDP-glucuronosyltransferase 1A6; UGT1A6; UGP1A1; UGT1A7

Species

Mus musculus (Mouse)

Expression Region

27-531

Target Protein Sequence

DKLLVVPQDGSHWLSMKEIVEHLSERGHDIMVLVPEVNLLLGESKYYRRKIFSVTYSLEE LQTRFRTFGNNHFLPGASLMGPLREYRNNMIVVDMFFSNCQSLLKDSATLSFLRENKFDA LFTDPAMPCGVILAEYLNLPSVYLFRGFPCSLEHMLGQSPSPVSYVPRFYTKFSDHMTFP QRLANFIVNILENYLYYCLYSKYEIIASDLLKRDVSLPSLHQNSLWLLRYDFVFEYPRPV MPNMIFLGGINCKKKGKLTQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGR IPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPM VMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHK DRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFK CCAYGCRKCFGGKGRVKKSHKSKTH

Protein Length

Full Length of Mature Protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. Conjugates small planar phenolic molecules such as 4-nitrophenol, 1-naphthol, and 4-methylumbelliferone. The bulky phenol 4-hydroxybiphenyl, androgens and estrogens are not substrates. 2-hydroxybiphenyl is an excellent substrate.

Gene References into Functions

the difference in expression levels between Ugt1a6a and Ugt1a6b in the hippocampus led us to speculate that Ugt1a6a is likely the predominant catalyst of serotonin glucuronidation in the mouse brain. PMID: 23089803

Subcellular Location

Microsome. Endoplasmic reticulum membrane; Single-pass membrane protein.

Protein Families

UDP-glycosyltransferase family

Tissue Specificity

Expressed in liver, kidney and at very low levels in colon.

Database Links

KEGG: mmu:94284

STRING: 10090.ENSMUSP00000014263

UniGene: Mm.300095

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-CF723742MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse UDP-glucuronosyltransferase 1-6 (Ugt1a6)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage