Recombinant Mouse Vesicle-associated membrane protein 4(Vamp4)

Code CSB-CF025783MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O70480
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALAAAILLLMIIILIVVKFRT
Source in vitro E.coli expression system
Gene Names Vamp4
Protein Names Recommended name: Vesicle-associated membrane protein 4 Short name= VAMP-4
Expression Region 1-141
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the pathway that functions to remove an inhibitor (probably synaptotagmin-4) of calcium-triggered exocytosis during the maturation of secretory granules. May be a marker for this sorting pathway that is critical for remodeling the secretory response of granule (By similarity).
Subcellular Location Golgi apparatus, trans-Golgi network membrane, Single-pass type IV membrane protein
Protein Families Synaptobrevin family
Database Links

KEGG: mmu:53330

STRING: 10090.ENSMUSP00000051544

UniGene: Mm.10699

Related Products

Vamp4 Proteins

Vamp4 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.