Recombinant Protein hrpC2(hrpC2)

Code CSB-CF302117XAK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P80150
Storage Buffer Tris-based buffer,50% glycerol
Species Xanthomonas euvesicatoria
Sequence MLGDRVRATRYFAYSGEVAIAALVVAVIGLMILPLPTPMIDTLLGINITLSVVLLMVTMY VPDSISLSSFPSLLLFTTLLRLSLNIASTKSILLHAEAGHIIESFGELVVGGNLVVGLVV FLIITTVQFIVIAKGSERVAEVGARFTLDAMPGKQMSIDADLRGGNLTADEARRKRARLA MESQLHGGMDGAMKFVKGDAIAGLVITMVNILAGIVVGVTYHGMTAGDAANRFAILSVGD AMVSQIASLLISVAAGVMITRVANENETRLSSLGLDIGRQLTSNARALMAASVLLACFAF VPGFPAVLFLLLAAAVGAGGYTIWRKQRDISGTDQRKLPSASRKGAKGEAPHIRKNAPDF ASPLSMRLSPQLAALLDPARLDQAIESERRQLVELLGLPFPGIAIWQTESLQGMQYEVLI HDVPETRAELENTDDMQAALARQAISPLHARAHLFVGIQETQWMLEQVAVDYPGLVAEVN KAMPAQRIADVLRRLLEERIPVRNIKSILESLVVWGPKEKDLLMLTEYVRCDLGRYLAHT ATAGTGQLPAVMLDHAVEQLIRQSIRATAAGNFLALPPEQANQLVEQVERIVGDHAQHPL AVVASMDVRRYVRRMIEARLTWLQVYSFQELGSEVQLQPIGRVVV
Source in vitro E.coli expression system
Gene Names hrpC2
Protein Names Recommended name: Protein hrpC2
Expression Region 1-645
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the secretion of a proteinaceous elicitor of the hypersensitivity response in plants.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families FHIPEP (flagella/HR/invasion proteins export pore) family

Related Products

hrpC2 Proteins

hrpC2 Proteins for Xanthomonas euvesicatoria

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.