Recombinant Pseudomonas putida Xylene monooxygenase subunit 1(xylM)

Code CSB-CF324183FFZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P21395
Storage Buffer Tris-based buffer,50% glycerol
Species Pseudomonas putida (Arthrobacter siderocapsulatus)
Sequence MDTLRYYLIPVVTACGLIGFYYGGYWVWLGAATFPALMVLDVILPKDFSARKVSPFFADL TQYLQLPLMIGLYGLLVFGVENGRIELSEPLQVAGCILSLAWLSGVPTLPVSHELMHRRH WLPRKMAQLLAMFYGDPNRDIAHVNTHHLYLDTPLDSDTPYRGQTIYSFVISATVGSVKD AIKIEAETLRRKGQSPWNLSNKTYQYVALLLALPGLVSYLGGPALGLVTIASMIIAKGIV EGFNYFQHYGLVRDLDQPILLHHAWNHMGTIVRPLGCEITNHINHHIDGYTRFYELRPEK EAPQMPSLFVCFLLGLIPPLWFALIAKPKLRDWDQRYATPGERELAMAANKKAGWPLWCE SELGRVASI
Source in vitro E.coli expression system
Gene Names xylM
Protein Names Recommended name: Xylene monooxygenase subunit 1 EC= 1.14.15.-
Expression Region 1-369
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Oxidizes toluene and xylenes to (methyl)benzyl alcohols. The enzyme has a broad specificity and also oxidizes (methyl)benzyl alcohols to (methyl)benzaldehydes and indole to indoxyl.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Fatty acid desaturase type 1 family, AlkB subfamily

Related Products

xylM Proteins

xylM Proteins for Pseudomonas putida (Arthrobacter siderocapsulatus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.