Recombinant Rat ATP-binding cassette sub-family G member 5(Abcg5)

Code CSB-CF859583RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Abcg5
Uniprot No. Q99PE7
Alternative Names Abcg5; ATP-binding cassette sub-family G member 5; Sterolin-1
Species Rattus norvegicus (Rat)
Expression Region 1-652
Target Protein Sequence MSELPFLSPEGARGPHNNRGSQSSLEEGSVTGSEARHSLGVLNVSFSVSNRVGPWWNIKS CQQKWDRKILKDVSLYIESGQTMCILGSSGSGKTTLLDAISGRLRRTGTLEGEVFVNGCE LRRDQFQDCVSYLLQSDVFLSSLTVRETLRYTAMLALRSSSADFYDKKVEAVLTELSLSH VADQMIGNYNFGGISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANHIVLLLVELA RRNRIVIVTIHQPRSELFHHFDKIAILTYGELVFCGTPEEMLGFFNNCGYPCPEHSNPFD FYMDLTSVDTQSREREIETYKRVQMLESAFRQSDICHKILENIERTRHLKTLPMVPFKTK NPPGMFCKLGVLLRRVTRNLMRNKQVVIMRLVQNLIMGLFLIFYLLRVQNNMLKGAVQDR VGLLYQLVGATPYTGMLNAVNLFPMLRAVSDQESQDGLYQKWQMLLAYVLHALPFSIVAT VIFSSVCYWTLGLYPEVARFGYFSAALLAPHLIGEFLTLVLLGMVQNPNIVNSIVALLSI SGLLIGSGFIRNIEEMPIPLKILGYFTFQKYCCEILVVNEFYGLNFTCGGSNTSVPNNPM CSMTQGIQFIEKTCPGATSRFTTNFLILYSFIPTLVILGMVVFKVRDYLISR
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ABCG5 and ABCG8 form an obligate heterodimer that mediates Mg(2+)- and ATP-dependent sterol transport across the cell membrane. Plays an essential role in the selective transport of dietary plant sterols and cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. Required for normal sterol homeostasis. The heterodimer with ABCG8 has ATPase activity.
Gene References into Functions
  1. Amino acid substitution in the sterol transport protein Abcg5 controls serum marinobufagenin levels in spontaneously hypertensive rats. PMID: 28982675
  2. In contrast, the marked reduction of hepatic Abcg5/8 observed is an effect of the high sugar content of the diets. PMID: 25912874
  3. A missense mutation in Abcg5 in hypertensive rats results in deposition of plant sterols in the body, but does not change their biliary secretion and lymphatic absorption. PMID: 22484926
  4. Data reveal marked utilization of an Abcg5/Abcg8-independent mechanism for basal biliary cholesterol secretion in rats during lactation, but a dependence on Abcg5/g8 for maximal biliary cholesterol secretion. PMID: 20413720
  5. Mutation of Abcg5 in stroke-prone spontaneously hypertensive rats, compared with Wistar rats, did not influence the ability for intestinal sitosterol absorption regardless of the dose. PMID: 19966468
  6. Intestinal mRNA expression of Abcg5 (-47%) and Abcg8 (-43%) as well as Abcg5 protein contents are reduced in insulin-deficient animals. PMID: 14618236
  7. the previously identified Gly583Cys change in Abcg5 in three hypertension-susceptible rats is responsible for the sitosterolemia, but may not be a major determinant of blood pressure in these rats. PMID: 16026620
  8. These observations suggest that a mutation in Abcg5 does not greatly influence intestinal absorption of plant sterols in SHRSP rats, at least in comparison with Wistar rats. PMID: 19202267

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Protein Families ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity Detected in liver (at protein level). Expressed only in liver and intestine.
Database Links

KEGG: rno:114628

STRING: 10116.ENSRNOP00000007174

UniGene: Rn.74258

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1