Recombinant Rat Corticotropin-releasing factor receptor 1 (Crhr1)

Code CSB-CF005965RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Crhr1; Crhr; Corticotropin-releasing factor receptor 1; CRF-R-1; CRF-R1; CRFR-1; Corticotropin-releasing hormone receptor 1; CRH-R-1; CRH-R1
Species
Rattus norvegicus (Rat)
Expression Region
24-415
Target Protein Sequence
SLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNG YRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLR LRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQSNVAWCRLVTAAYNYFHVTNF FWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLHYDNEKCWFGKR PGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLL GITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQD KHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.
Gene References into Functions
  1. Irritability-like behavior following abstinence from ethanol exposure is partially mediated by activation of the CRF1 receptor. PMID: 28833238
  2. CRHR1 blockade using Antalarmin (ANT) improved behavioral impairments, while conferring neuroprotection and blunting neuroinflammation in all hippocampal sub-regions post ischemia. Also observed reduced BDNF and TrkB mRNA and protein levels at the hippocampus, and increased expression at the hypothalamus and amygdala post ischemia, site-specific alterations which were regularized by pre-ischemic CRHR1 blockade. PMID: 28647536
  3. These results indicate that the central CRF signal, rather than the peripheral CRF signal would be related to anxiety and other behavioral changes, and CRF1 receptor antagonism in the central nervous system may be critical for identifying drug candidates for anxiety and mood disorders PMID: 28689880
  4. Study found that bilateral microinjection of selective CRF1 receptor antagonist CP376395 into the bed nucleus of stria terminalis (BNST) decreased the bradycardiac response to arterial pressure increase without affecting the baroreflex tachycardiac response; CRF2 receptor antagonist antisauvagine-30 microinjection reduced the tachycardiac response to arterial pressure decrease without affecting the reflex bradycardia. PMID: 28612996
  5. the involvement of the HPA axis in traumainduced anxiety was demonstrated, and trauma-induced anxiety was attenuated by decreasing the hyperactivity of the HPA axis via miR34b by targeting CRHR1. PMID: 28498394
  6. Results suggest that corticotrophin-releasing factor type 1 receptor (CRF1) is involved in the modulation of the functions of the pituitary; moreover, protein expression and the distribution patterns of CRF1 are regulated by glucocorticoids in the rat anterior pituitary. PMID: 27801962
  7. These results revealed a prominent role for CRF1 signaling in mast cells as a positive modulator of stimuli-induced degranulation. PMID: 28684600
  8. age-related alterations in acute central anorexigenic and hypermetabolic effects of CRF show different non-parallel patterns in males and females. Our findings underline the importance of gender differences. They also call the attention to the differential age-related changes in the CRF1 and CRF2 receptor systems PMID: 27637621
  9. switch in G protein coupling for type 1 corticotropin-releasing factor receptors promotes excitability in epileptic brains PMID: 27303056
  10. Study identified the activation of CRFR1 in the basolateral amygdala as a key mechanism interfering with the effectiveness of immediate fear extinction training. PMID: 27844053
  11. The findings demonstrate that the long-term effect of acute stress on the expression of cocaine locomotor sensitization is partially mediated by CRFR1 in the ventromedial caudate putamen. PMID: 28431969
  12. Chronic noise significantly accelerated the progressive overproduction of corticosterone and upregulated CRF and CRFR1 mRNA and protein, both of which persisted 7-14days after noise exposure. PMID: 27538655
  13. maternal care is impaired by Bed Nucleus Stria Terminalis CRF-R1 activation, and this appears to be the result of a central action, rather than an effect of elevated circulating levels of CORT. PMID: 26630389
  14. Exposure to acute traumatic stress in early adolescent can cause permanent changes in neural network, resulting in dysregulation of corticotrophin releasing factor expression, miR-34c expression in hypothalamus, anxiety-like behavior, and memory impairment, suggesting that the miR-34c expression in hypothalamus may be an important factor involved in post traumatic stress syndrome. PMID: 26925271
  15. Study demonstrates sex differences in CRF receptor 1 and 2 mRNA changes within unique subnuclei of the dorsal raphe nucleus and the posterior ventral tegmental area PMID: 26696011
  16. Competing roles of CRHR1 and CRHR2 on stress-induced in vivo serotonin synthesis. PMID: 26454419
  17. CRF1 receptor levels did not differ significantly between genotypes but receptor blockade normalized both cue- and contextual fear in SERT(-/-) during acquisition, but not expression of fear-potentiated startle PMID: 26302762
  18. Both acute and chronic noise increased CRH-R1 mRNA in the hypothalamus but decreased it in the hippocampus. PMID: 26333123
  19. Study revealed that the alteration of central CRFR1 expression might play an important role in etiology of post-traumatic stress disorder in adulthood PMID: 25882722
  20. Findings suggest that an early potentiation of CRF signaling at CRFR1 occurs following opioid exposure that begins to drive both opioid-induced hyperalgesia and eventually intake escalation. PMID: 24330252
  21. The point mutations occurring in the CRF1-R gene of msP rats do not seem to influence basal anxiety while they appear to affect active responses to stress. PMID: 25260340
  22. Activation of CRF1 receptors is required for the emergence of nicotine abstinence-induced anxiety-like behavior, hyperalgesia and excessive nicotine intake. PMID: 23869743
  23. the increase in CRHR1 expression in the hypothalamus of stressed rats correlates with a decrease in the repressive chromatin state caused by reduced H3K9 trimethylation levels. PMID: 24867333
  24. Neuromodulatory effects of interleukin-6 (IL-6) and corticotropin-releasing factor receptor (CRFR) 1 in visceral pain and stress-induced defecation in the WKY rat model of irritable bowel syndrome were investigated. PMID: 25260633
  25. results indicate that CRF1 receptors in the dPAG play a pervasive role in the regulation of defensive responses associated with both generalized anxiety and panic. Recruitment of CRF2 receptors only impacts upon the former type of behaviors. PMID: 25146701
  26. impaired miR449a expression causes dysregulation of Crhr1 expression in the anterior pituitary, resulting in prolonged HPA axis activation in restrained Low birth weight offspring. PMID: 25480379
  27. Our results implicate CRHR1 and CRHR2 in coordinating the regulation of CRH neuronal activity in stress and behavioral responses. PMID: 25275258
  28. We present evidence demonstrating prenatal hypoxia exposure induced anxiety-like behavior in adult male rat offspring and CRHR1 in paraventricular nucleus of the hypothalamus is involved. PMID: 25433848
  29. The analgesic effect can be mediated by both CRF1 and CRF2 receptors. CRF-1 receptor, in contrast to the CRF2 receptors, may be involved in the regulation of the basal level of pain sensitivity. PMID: 25665407
  30. Water-avoidance stress may activate peripheral CRF1 but not CRF2 signaling and stimulates gastric contractions without altering gastric emptying PMID: 23645119
  31. results suggest that post-stress alcohol drinking may be driven by a high-nociception high-arousal state, and that brain CRF1R signaling mediates these stress effects. PMID: 24269607
  32. This study demonistrated that crhr1 links peripuberty stress with deficits in social and stress-coping behaviors in rats model. PMID: 24630468
  33. findings demonstrate that stress affects CRF1 expression in brain but also in ova, pointing to a possible mechanism of transgenerational transmission. PMID: 23726318
  34. Data show that corticotropin releasing factor receptor 1 (CRF1) antagonists, NGD 98-2 and NGD 9002 prevented icv CRF-induced colonic secretomotor stimulation and blocked the induction of visceral sensitization. PMID: 24040053
  35. Gestational intermittent hypoxia elicited a sex-dependent anxiety-like behavior in male offspring and activation of corticotropin-releasing hormone and CRH type-1 receptor mRNA in the hypothalamic paraventricular nucleus and in male hypothalamus. PMID: 23529784
  36. MiR-449a plays an important role in stress-induced, glucocorticoid-mediated downregulation of CRF-R1 expression. PMID: 23893957
  37. The CRHR1-triggered ERK 1/2 pathway is involved in the activation of p53 in rat hepatic cells. PMID: 23538210
  38. The results of this study suggested that differences in monoaminergic neurotransmission and CRFR1 expression are associated with the coping strategy adopted by the animal and with the tendency to develop depression-related behaviors. PMID: 23732652
  39. Peripheral CRF stimulates gastric contractions through CRF(1). PMID: 23205497
  40. CRFR1 signaling plays a role in the anxiogenic effects of calcitonin gene-related peptide (CGRP) within the bed nucleus of stria terminalis. PMID: 23376701
  41. Non-pain-related activation of CRF1 receptors in the amygdala can trigger pain-responses in normal animals. PMID: 23410057
  42. These findings clearly demonstrate a gender-selective effect of gestational intermittent hypoxia to increase anxiety-like behavior and this anxiogenic effect might be linked to embryogenically-driven upregulation of PVN CRHR1. PMID: 23164543
  43. CRHR1 agonism stimulates rat and mouse fetal testis steroidogenesis PMID: 23133512
  44. Corticotropin-releasing factor receptor binding in the amygdala changes across puberty in a sex-specific manner PMID: 23117932
  45. CRHR1 does not have a role in basal alcohol intake or relapse-like drinking situations with a low stress load. PMID: 22113086
  46. During adolescence, nicotine reward is enhanced by recent stressor exposure in a manner that involves signaling at CRF-R1. PMID: 21720754
  47. Data suggest that corticotropin releasing hormone (CRH) regulates dendritic outgrowth in cultured hippocampal neurons/pyramidal cells; signaling via CRH-R1 stimulates dendritic growth; CRH-R2 activation results in inhibition of dendritic growth. PMID: 22249942
  48. The corticotropin-releasing factor CRF(1) receptor antagonist R278995/CRA0450 is centrally active under standard conditions as it inhibits REM sleep and promotes wakefulness. PMID: 22314225
  49. Intracerebroventricular corticotropin-releasing factor and restraint increased both Fos-positive CRF and non-CRF neurons in the parvocellular paraventricular nucleus of the hypothalamus through activation of CRF1 and/or CRF2. PMID: 21964377
  50. The non-competitive antagonist behaviour appeared to be correlated to the CRF(1) receptor off-rate kinetics. PMID: 21449919

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Detected in brain, especially in cerebellum. Detected in pituitary gland, and at lower levels in the olfactory bulb.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1