Recombinant Rat Potassium channel subfamily K member 15(Kcnk15)

Code CSB-CF823194RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8R5I0
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MRKQSARTAALILCILSYLLVGAAVFDALESEAERSRQRLLARKRGEFRRKYRFSADDYR ELERLALQAEPHRAGRQWRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPL TLVTFQSLGERLNALVRCLLLAAKRCLGLRRPHVSAENMVVAGLLLCAATLALGAAAFAH FEGWTFFHAYYYCFITLTTIGFGDFVALQRDEALQKKPPYVAFSFLYILLGLTVIGAFLN LVVLRFLASAEAPERAALRRASVFRRGAPESRVRIPYPFHPLETWARDNPAFSPPLSPEA VHDCHSSPDRLRARRKSI
Source in vitro E.coli expression system
Gene Names Kcnk15
Protein Names Recommended name: Potassium channel subfamily K member 15 Alternative name(s): Acid-sensitive potassium channel protein TASK-5 Short name= rTASK-5 TWIK-related acid-sensitive K(+) channel 5
Expression Region 1-318
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable potassium channel subunit. No channel activity observed in heterologous systems. May need to associate with another protein to form a functional channel.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Brain-specific. Highly expressed in auditory nuclei, in Purkinje cells and in olfactory bulb mitral cells.
Database Links

KEGG: rno:156873

STRING: 10116.ENSRNOP00000014411

UniGene: Rn.161865

Related Products

Kcnk15 Proteins

Kcnk15 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.