Recombinant Rat Small conductance calcium-activated potassium channel protein 3 (Kcnn3)

Code CSB-CF012085RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Kcnn3
Uniprot No.
Alternative Names
Kcnn3; Small conductance calcium-activated potassium channel protein 3; SK3; SKCa 3; SKCa3; KCa2.3
Species
Rattus norvegicus (Rat)
Expression Region
1-732
Target Protein Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQPPPPSAPPAVPQQPPGPLLQPQPPQ LQQQQQQQQQQQQQQQQQQQAPLHPLPQLAQLQSQLVHPGLLHSSPTAFRAPNSANSTAI LHPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCK YSGGVMKPLSRLSASRRNLIEAEPEGQPLQLFSPSNPPEIIISSREDNHAHQTLLHHPNA THNHQHAGTTAGSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMV IETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMT YERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIA RVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVR VCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVV AVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRK HQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSL ESKLEHLTASFNSLPLLIADTLRQQQQQLLTAFVEARGISVAVGTSHAPPSDSPIGISST SFPTPYTSSSSC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization.
Gene References into Functions
  1. SK3 was found in ventricular myocyte mitochondria. Agonists protected against ischemia-reperfusion injury in vivo. PMID: 28342809
  2. SK3 doesn't contribute to the enhanced ability of microglia to migrate and invade when in anti-inflammatory states. PMID: 25148577
  3. Whole-cell measurements of PC12 cells transfected with Endophilin A3 showed a reduction of KCa2.3 specific Cs(+) currents indicating that the interaction of Endophilin A3 with K(Ca)2.3 channels also occurs in mammalian cells PMID: 25096234
  4. the hormonal effect on SK3 caused by 17beta-estradiol includes divergent regulation at mRNA and protein levels. PMID: 24505302
  5. SK3 strongly increased during postnatal development and maintained throughout postnatal development and in the adult brain PMID: 24096910
  6. Data suggest that down-regulation of Kcnn3 in vascular endothelium in both male and female offspring of pregnant rats with elevated blood levels of testosterone/androgen (as in pre-eclampsia) may be involved in development of hypertension. PMID: 23966325
  7. A functional interplay of a trimeric complex that transforms incoming signals via SK3-channel activation into the local rearrangement of the cytoskeleton in early steps of neuronal differentiation involving nWASP and Abi-1 actin binding proteins. PMID: 21464958
  8. There was a statistically significant difference in Kcnn3 expression in studied brain regions after isolation rearing. PMID: 20662937
  9. Diabetes inhibits mRNA and protein expression of both SK3 and IK1 in the cavernous tissue of diabetic rats. This could play a key role in the development of erectile dysfunction in diabetic rats. PMID: 20364152
  10. Diabetes mellitus can significantly reduce erectile function in rats, which may be related to the decreased expression of SK3 in the corpus cavernosum. PMID: 20369552
  11. the SK3 subunit of small conductance Ca2+-activated K+ channels interacts with both SK1 and SK2 subunits PMID: 14559917
  12. SK3-1C is a dominant-negative suppressor of SKCa and IKCa channels PMID: 14638680
  13. Variations in SK3 channel distribution and expression could contribute to differences in dopamine-related functions in the rat. PMID: 15170822
  14. Immunocytochemical localization of small-conductance, calcium-dependent potassium channels in astrocytes of the rat supraoptic nucleus. PMID: 16134141
  15. The GnRH neurones expressed transcripts for SK1-3 channels. PMID: 16627563
  16. N-C interactions influence SK3 channel function. PMID: 17167222
  17. Action potential activity evoked by motor neurons in muscle fibers is both necessary and sufficient to account for the physiological down-regulation of SK3 channels in the non-junctional membrane of skeletal muscle. PMID: 18703580
  18. Formation of cellular projections in neural progenitor cells depends on SK3 channel activity. PMID: 17459146

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Potassium channel KCNN family, KCa2.3/KCNN3 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1