Recombinant Rat Vomeronasal type-1 receptor A14(V1ra14)

Code CSB-CF686326RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5J3K9
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MMGVQICQGMMSEIPFFSPPPQFSYMMNKNIRLHTDSNIRNTFFTDIGIGISANSLLLLF NIFKLTRGQRSRLTDLPIGLLSLINLLMLLMAAFIATDTFISWKGWDDIICKFLVYLYRT FRGLSLCTSCLLSVLQAIILSPRSSCLAKFKHKPPHHISCAILSLSVLYMFIGSHLLVSI IATPNLTTNDFIHVTQSCSILPMSYLMQCMFSTLLAIRDVFLISLMVLSTWYMVALLCRH RKQTRHLQGTSLSPKASPEQRATRSILMLMSLFVLMSVFDSIVCSSRTMYLNDPISYSIQ LFMVHIYATVSPFVFIVTEKHIVNFLRSVCEGDECLNIH
Source in vitro E.coli expression system
Gene Names V1ra14
Protein Names Recommended name: Vomeronasal type-1 receptor A14
Expression Region 1-339
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative pheromone receptor implicated in the regulation of social as well as reproductive behavior.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

UniGene: Rn.215804

Related Products

V1ra14 Proteins

V1ra14 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.