Recombinant Rhinolophus ferrumequinum Dolichyldiphosphatase 1(DOLPP1)

Code CSB-CF007115RKD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B2KI79
Storage Buffer Tris-based buffer,50% glycerol
Species Rhinolophus ferrumequinum (Greater horseshoe bat)
Sequence MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVVIIVGFVTLIIFKRELHTI SFLGGLVLNEGVNWLIKHVIQEPRPCGGPHPTVGTKYGMPSSHSQFMWFFSVYSFLFLYL RMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVLYGGVAGSLMAIAWF AFTQEVLTPLFPRIAAWPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ
Source in vitro E.coli expression system
Gene Names DOLPP1
Protein Names Recommended name: Dolichyldiphosphatase 1 EC= 3.6.1.43 Alternative name(s): Dolichyl pyrophosphate phosphatase 1
Expression Region 1-238
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for efficient N-glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Dolichyldiphosphatase family

Related Products

DOLPP1 Proteins

DOLPP1 Proteins for Rhinolophus ferrumequinum (Greater horseshoe bat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.