Recombinant Serpentine receptor class alpha-12(sra-12)

Code CSB-CF720228CXX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q60T34
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis briggsae
Sequence MSCASEVQAQLFTHPVQIIYACVQTVLFLATIIGSLLAIVQLCKKTTIPDSTKVLLIGAL FFANAHELAYFSSPFKVFKMNLFHTNTSCYPLASTLECIPTTTVLAMGISGNMLIQSALS IFRLLATIFPVCYSRMRALPGVVLLFMVLIPSFLSYSWIRSDIVLDDYQMFCSQWSANIS SRANTYLEYCSYLTVAHIIINALIILRNRSVESKCRFDVQQRYLNSETLKTTQTICYLSI AQFLAMFLYSGGVLFMRKNQKNIPTLIYINVIVWVYAPPYACVSLAPLILFSLWNLKKQR QIRIQSITVQKETQEDHIRKLQLSWG
Source in vitro E.coli expression system
Gene Names sra-12
Protein Names Recommended name: Serpentine receptor class alpha-12 Short name= Protein sra-12
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Nematode receptor-like protein sra family
Database Links

KEGG: cbr:CBG20641

Related Products

sra-12 Proteins

sra-12 Proteins for Caenorhabditis briggsae

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.