Recombinant Xenopus laevis 2-acylglycerol O-acyltransferase 1(mogat1)

Code CSB-CF659445XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3KPP4
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xenopus laevis (African clawed frog)
Sequence MKVEFAPLNIPLARRLQTTAVFQWVFSFLLLAQCCIGIFICLVLARVWLLLALYVLWLYL DWETPQAGGRRWEWVRNWPVWKYFKDYFPIRLVKTCDLDPQHNYIMGFHPHGVLVAGAFG NFCTNYTGFKELFPGLTPYLHILPFWFRCPFFREYIMSVGLVSASKKSVNHVLSKEDGGN VSIIVTGGAEESLDAHPGSLTLNILKRKGFIKVALKRGAYLVPVFSFGENELFQQVSNPK GSLLRCVQERLQRIMGLAMPLFHARGIFQYSFGLMPYRMPIHTVVGRPIPVKETSHPTQE EIESLHQQYLGALQELFEEHKKRYGIPEHESLIFI
Source in vitro E.coli expression system
Gene Names mogat1
Protein Names Recommended name: 2-acylglycerol O-acyltransferase 1 EC= 2.3.1.22 Alternative name(s): Acyl-CoA:monoacylglycerol acyltransferase 1 Short name= MGAT1 Monoacylglycerol O-acyltransferase 1
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Diacylglycerol acyltransferase family
Database Links

KEGG: xla:380391

UniGene: Xl.7867

Related Products

mogat1 Proteins

mogat1 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.