Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004961HU |
| Product Type | Tumor Necrosis Factor |
| Size |
US$52Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | O14798 |
| Lead Time | 5-10 business days |
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Alias | Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor 3; TRAIL-R3; TRAIL Receptor Without an Intracellular Domain; CD263; TNFRSF10C; DCR1; LIT; TRAILR3; TRID |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is less than 200 ng/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA |
| Research Area | Cancer |
| Source | Mammalian cell |
| Gene Names | TNFRSF10C |
| Expression Region | 26-221aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 21.78 kDa |
| Protein Description | Partial |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand. |
| Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor |
| Tissue Specificity | Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart. |
| Database Links |
HGNC: 11906 OMIM: 603613 KEGG: hsa:8794 STRING: 9606.ENSP00000349324 UniGene: Hs.655801 |
| Pathway |
Apoptosis
Necroptosis Natural killer cell mediated cytotoxicity |
TNFRSF10C Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA023966KA01HU | TNFRSF10C Antibody | Human | ELISA,WB,IHC |
| CSB-PA005882 | TNFRSF10C Antibody | Human | WB,ELISA |
| CSB-PA08189B0Rb | TNFRSF10C Antibody, HRP conjugated | Human | ELISA |
| CSB-PA08189C0Rb | TNFRSF10C Antibody, FITC conjugated | Human | ELISA |
| CSB-PA08189D0Rb | TNFRSF10C Antibody, Biotin conjugated | Human | ELISA |
TNFRSF10C Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA08189A0Rb | TNFRSF10C Antibody | Human | ELISA, IF |
TNFRSF10C Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-AP004981HU | Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C),partial (Active) | Mammalian cell |
| CSB-YP023966HU CSB-EP023966HU CSB-BP023966HU CSB-MP023966HU |
Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C) | Yeast E.coli Baculovirus Mammalian cell |
TNFRSF10C ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E04748h | Human tumor necrosis factor-related apoptosis-inducing ligand receptor 3,TRAIL-R3 ELISA Kit | serum, plasma, tissue homogenates | 19.5 pg/mL |
Recombinant Human Immunoglobulin iota chain(VPREB1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Muscarinic acetylcholine receptor M3(CHRM3),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Alpha-1-antiproteinase(Serpina1)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human ATP synthase-coupling factor 6, mitochondrial(ATP5J)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Interferon regulatory factor 8(Irf8)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Aldehyde dehydrogenase family 1 member A3(ALDH1A3)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Cysteine-rich protein 1(CRIP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Pyridoxal phosphate phosphatase(Pdxp)
Express system: Yeast
Species: Mus musculus (Mouse)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.