Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C),partial (Active)

In Stock
Code CSB-AP004961HU
Product Type Tumor Necrosis Factor
Size US$52Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. O14798
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Alias Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor 3; TRAIL-R3; TRAIL Receptor Without an Intracellular Domain; CD263; TNFRSF10C; DCR1; LIT; TRAILR3; TRID
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is less than 200 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
Research Area Cancer
Source Mammalian cell
Gene Names TNFRSF10C
Expression Region 26-221aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 21.78 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.
Database Links

HGNC: 11906

OMIM: 603613

KEGG: hsa:8794

STRING: 9606.ENSP00000349324

UniGene: Hs.655801

Pathway Apoptosis
Necroptosis
Natural killer cell mediated cytotoxicity

Related Products

TNFRSF10C Antibodies

TNFRSF10C Antibodies for Homo sapiens (Human)

TNFRSF10C Antibodies for Human

TNFRSF10C Proteins

TNFRSF10C Proteins for Homo sapiens (Human)

TNFRSF10C ELISA Kit

TNFRSF10C ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.