Name: Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C),partial (Active)
Brand: CUSABIO
SKU: CSB-AP004961HU

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is less than 200 ng/ml.
Target Names	TNFRSF10C
Uniprot No.	O14798
Research Area	Cancer
Alternative Names	TNFRSF10C; DCR1; LIT; TRAILR3; TRID; UNQ321/PRO366; Tumor necrosis factor receptor superfamily member 10C; Antagonist decoy receptor for TRAIL/Apo-2L; Decoy TRAIL receptor without death domain; Decoy receptor 1; DcR1; Lymphocyte inhibitor of TRAIL; TNF-related apoptosis-inducing ligand receptor 3; TRAIL receptor 3; TRAIL-R3; TRAIL receptor without an intracellular domain; CD antigen CD263
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	26-221aa
Complete Sequence	ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
Mol. Weight	21.78 kDa
Protein Length	Partial
Tag Info	C-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.
Gene References into Functions	High levels of TRAIL-R3 and CCR-2 expression in tumor epithelial cells identified patients with early breast cancer with poor outcomes. PMID: 28420351 DcR1 levels in serum sample which were significantly lower in AMD patients. PMID: 24534820 DcR1 upregulation mediates temozolomide resistance. PMID: 25808868 GATA4 and DcR1 promoter hypermethylation is tumor specific event in glioblastoma but they promoter methylation cannot be considered as a prognostic marker of glioblastoma survival. PMID: 23320456 Primary EOC is associated to a lower TRAIL-R3 expression. PMID: 22555108 Data show that about 20% of AML patients highly expressed decoy receptor TRAIL-R3, which was strongly correlated to a shortened overall survival. PMID: 21281967 Decoy receptors DcR1 and DcR2 on CD8+ T cells, but not on CD4-positive T cells, are positively correlated with patients' DAS scores. PMID: 20799941 Results suggest that DcR1 expression occurs in a subset of endometrial carcinomas and may contribute to resistance to TRAIL-induced apoptosis. PMID: 19936781 analysis of the transcription initiation sites and promoter structure of the TRAIL-R3 gene PMID: 12417331 cloned and characterized a p53 consensus element located within the first intron of the TRAIL-R3 gene PMID: 14623878 Our results demonstrate that DcR1 and DcR2 genes are frequently methylated in various tumor types, and aberrant methylation was the cause for silencing of DcR1 and DcR2 expression. PMID: 14999791 The DcR1 had no death domain and was anchored to the membrane via a glycophosphatidyl inositol tail. PMID: 15538968 Resistance to TRAIL-induced apoptosis in acute myeloid leukemia cells is associated with expression of TRAIL-R3. PMID: 15921376 tryptophol induces apoptosis through DR5 and the resistance of PBL to tryptophol-induced apoptosis might be due to competition from DcR1 PMID: 17690453 p53 negatively regulates oxaliplatin-mediated TRAIL-induced apoptotic activity through DcR1 upregulation. PMID: 18345033 TRAILR3 (TNF-related apoptosis inducing ligand receptor 3) levels were significantly higher in lung parenchyma in subjects with emphysema PMID: 18511705 Liver metastases with low DcR1/TNFRSF10C mRNA expression were more likely to present with extrahepatic metastases PMID: 18590575 inactivation of TNFRSF10C by chromosomal deletion and promoter methylation may play an important role in prostate cancer development PMID: 19035483 Low DCR1 is associated with non-small cell lung cancer. PMID: 19661294 Show More Hide All
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity	Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.
Database Links	HGNC: 11906 OMIM: 603613 KEGG: hsa:8794 STRING: 9606.ENSP00000349324 UniGene: Hs.655801

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-AP004961HU
Size	InquiryPurchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tumor necrosis factor receptor superfamily member 10C(TNFRSF10C),partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage