Recombinant Chicken Gap junction alpha-8 protein (GJA8)

Code CSB-CF009449CH
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GJA8
Uniprot No.
Alternative Names
GJA8; Gap junction alpha-8 protein; Connexin-45.6; Cx45.6
Species
Gallus gallus (Chicken)
Expression Region
2-400
Target Protein Sequence
GDWSFLGNILEQVNEQSTVIGRVWLTVLFIFRILILGTAAELVWGDEQSDFVCNTQQPGCENVCYDEAFPISHIRLWVLQIIFVSTPSLVYFGHAVHHVRMEEKRKEREEAERRQQAEVDEEKLPLAPNQNKGNNPDGTKKFRLEGTLLRTYILHIIFKTLFEVGFIVGQYFLYGFRILPLYRCGRWPCPNLVDCFVSRPTEKTIFIMFMLVVAAVSLFLNLVEISHLILKRIRRALRRPAEEQMGEVPEKPLHAIAVSSIPKAKGYKLLEEEKPVSHYFPLTEVGVEPSPLPSAFNEFEEKIGMGPLEDLSRAFDERLPSYAQAKEPEEEKVKAEEEEEQEEEQQAPQEEPGVKKAEEEVVSDEVEGPSAPAELATDVRSLSRLSKASSRARSDDLTV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Structural component of eye lens gap junctions. Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell via the central pore.
Gene References into Functions
  1. the role of the charged residues at the end of TM-1 in voltage sensing in Cx26, Cx46, and Cx50. PMID: 27143357
  2. Cx50 is phosphorylated in vivo by PKA at Ser-395, which promotes increased dye permeability of Cx50 channels and plays an important role in metabolic coupling and transport in lens fibers PMID: 21454606
  3. Val(362) is important for maintaining the helical structure and is crucial for the role of Cx50 in promoting lens epithelial-fiber differentiation PMID: 20395299
  4. These data suggest that the N-terminus plays a critical role in determining many of biophysical properties of Cx45.6 gap junctional channels, including molecular permeability and voltage gating. PMID: 16931554
  5. study concludes that the expression of Cx45.6, but not Cx45.6-dependent gap junction channels, is involved in lens epithelial-fiber cell differentiation, and the C-terminal domain of Cx45.6 plays a predominant role in mediating this process PMID: 17895360
  6. Phosphorylation at Ser(364) appears to stimulate turnover primarily through proteasome pathway; this phosphorylation inhibits cleavage by caspase-3. PMID: 18649174
  7. Human Cx50 is functionally involved in cell differentiation and lens development, and the E48K mutant promotes primary lens cell differentiation indistinguishable from wild-type chicken Cx50, despite its lack of junctional channel function PMID: 19126675

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X