Recombinant Mouse Aquaporin-11 (Aqp11)

Code CSB-CF804799MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Aqp11
Uniprot No.
Alternative Names
Aqp11; Aquaporin-11; AQP-11
Species
Mus musculus (Mouse)
Expression Region
1-271
Target Protein Sequence
MSALLGLRPEVQDTCISLGLMLLFVLFVGLARVIARQQLHRPVVHAFVLEFLATFQLCCCTHELQVLSEQDSAHPTWTLTLIYFFSLVHGLTLVGTASNPCGVMMQMILGGMSPEMGAVRLLAQLVSALCSRYCISALWSLSLTKYHYDERILACRNPIHTDMSKAIIIEAICSFIFHSALLHFQEVRTKLRIHLLAALITFLAYAGGSLTGALFNPALALSLHFPCFDELFYKFFVVYWLAPSVGVLMMILMFSFFLPWLHNNQMTNKKE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Channel protein that facilitates the transport of water, glycerol and hydrogen peroxide across membrane of cell or organelles guaranteeing intracellular homeostasis in several organes like liver, kidney and brain. In situation of stress, participates in endoplasmic reticulum (ER) homeostasis by regulating redox homeostasis through the transport of hydrogen peroxide across the endoplasmic reticulum membrane thereby regulating the oxidative stress through the NADPH oxidase 2 pathway. Plays a role by maintaining an environment suitable for translation or protein foldings in the ER lumen namely by participating in the PKD1 glycosylation processing resulting in regulation of PKD1 membrane trafficking thereby preventing the accumulation of unfolding protein in ER. Plays a role in the proximal tubule function by regulating its endosomal acidification. May play a role in postnatal kidney development.
Gene References into Functions
  1. We conclude that Aqp11(-/-) mice develop cyst-like dilated proximal tubules without documented cysts at time of death. PMID: 27582095
  2. The results suggest the involvement of autophagy in the development and maintenance of kidney cysts in AQP11(-/-) mice. PMID: 27916883
  3. AQP11 was expressed mainly in the pia matter with limited expression in the capillary at early postnatal stages at P1~P14. PMID: 27258268
  4. impaired glycosylation processing and aberrant membrane trafficking of PC-1 in AQP11(-/-) mice could be a key mechanism of cystogenesis in AQP11(-/-) mice PMID: 24854278
  5. Our results indicate an important role for AQP11 to prevent glucose-induced oxidative stress in proximal tubules. PMID: 23486012
  6. deletion of AQP11 results in disrupted rough endoplasmic reticulum homeostasis and increased sensitivity to rough endoplasmic reticulum injury upon metabolic challenge with amino acid PMID: 23275615
  7. mouse aquaporin 11 could be involved in slow but constant water movement across the membrane PMID: 21251984
  8. important role during salivary gland development PMID: 20156259
  9. Immunohistochemistry of mouse testis across development pinpointed first appearance of AQP11 coinciding with late stage elongated spermatids. cDNA analysis yielded conformation of sequence. Western blotting revealed additional forms. PMID: 19812234
  10. AQP11 is essential for the proximal tubular function PMID: 16107722
  11. These results provide new insights into the physiological roles of AQP11. PMID: 18606867
  12. mutation causing single amino acid substitution in aquaporin 11 causes renal failure in sudden juvenile death syndrome mutant mice PMID: 18701606

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, perinuclear region.
Protein Families
MIP/aquaporin (TC 1.A.8) family, AQP11/AQP12 subfamily
Tissue Specificity
Highly expressed in the S1 proximal tubule segment,. Expressed in the testis, kidney, and liver. Weakly expressed in the heart, brain, and muscle. Highly expressed in the testis. Expressed in the proximal tubule of the cortex of 8-day-old mouse kidney. Ex
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1