Recombinant Mouse Aquaporin-9 (Aqp9)

Code CSB-CF888326MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Aqp9
Uniprot No.
Alternative Names
Aqp9; Aquaporin-9; AQP-9; Aquaglyceroporin-9
Species
Mus musculus (Mouse)
Expression Region
1-295
Target Protein Sequence
MPSEKDRAKKNLVQRLALKSCLAKETLSEFLGTFIMIVLGCGSIAQAVLSREKAGGIITINIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAFVGAATVFGIYYDGLMAFADGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIFDSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTFGNNFWWIPVVGPMIGAVLGGLIYVLFIQMHHSNPDPEVKAEPAENNLEKHELSVIM
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Forms a water channel with a broad specificity. Also permeable glycerol and urea. Mediates passage of a wide variety of small, non-charged solutes including carbamides, polyols, purines, and pyrimidines.
Gene References into Functions
  1. AQP9 -selectively expressed in catecholaminergic neurons-is permeable to MPP+ and this aquaglyceroporin contributes to the selective vulnerability of nigral dopaminergic neurons by providing an entry route for parkinsonogenic toxins. PMID: 29566083
  2. The results of this study show Increase of aquaporin 9 expression in astrocytes participates in astrogliosis. PMID: 28419510
  3. AQP-7 and -9 showed differential staining pattern in different stages of mouse estrus cycle. AQP-7 and -9-mediated glycerol transport in tanycyte cells might be under hormonal control to use glycerol as a potential energy substrate during mouse estrus cycle. PMID: 27746040
  4. Intracranial hemorrhage increased AQP9 protein levels in the hippocampus. Lack of AQP9 impairs neovascularization and exaggerates neuronal death following ICH. PMID: 27885529
  5. the dynamics of liver AQP9 involvement in male rodent glycerol homeostasis our model may be adapted to the human liver serving as an important module of a whole body-model of the glucose metabolism both in health and metabolic diseases. PMID: 28049557
  6. these findings suggest that AQP9 is required for the development of sensitization during cutaneous acquired immune responses via regulating neutrophil function PMID: 26489517
  7. Our findings implicate the involvement of AQP9 in H2O2 transport in human and mice cells. PMID: 26837049
  8. Results suggest implication of AQP9 in liver steatosis. The reduction of hepatocyte AQP9 and, consequently, glycerol permeability might be a defensive mechanism to counteract further fat infiltration in liver parenchyma. PMID: 24205128
  9. The identification of novel, high affinity AQP9 inhibitors in an intracellular binding site. PMID: 23448163
  10. Aquaporin 9-deficiency results in decreased redox-sensitive erythrocyte cation channel activity in mice. PMID: 22836670
  11. Data indicate selective expression of aquaporins 3 and 8 in primitive erythroblasts and aquaporins 1 and 9 in adult definitive erythroblasts. PMID: 23243273
  12. Besides being markedly lower than that in Aqp9(+/+) mice, the liver glycerol permeability of the Aqp9 null mice did not increase during fasting. PMID: 22316404
  13. AQP9 and unidentified UT-A urea channels constitute primary but redundant urea facilitators in murine hepatocytes PMID: 23042941
  14. Our results not only confirm the presence of AQP9 in astrocytes but also suggest that changes in AQP9 expression alter glial energy metabolism PMID: 22842525
  15. AQP9 plays an important role in the development of microgravity-induced bone loss, and may be a potential target for the prevention or management of microgravity-induced bone loss. PMID: 22390930
  16. Acetaldehyde downregulates hepatocyte aquaporin 9 (AQP9) mRNA and AQP9 protein, while ethanol decreases hepatocyte AQP9 mRNA but not AQP9 protein. PMID: 21294757
  17. Aquaporin-9 protein is the primary route of hepatocyte glycerol uptake for glycerol gluconeogenesis in mice. PMID: 22081610
  18. The examination was performed whether aquaporin (AQP) 9 is expressed in normal skeletal muscle at mRNA and protein levels. PMID: 19629726
  19. The results suggest that in addition to the initial uptake of trivalent inorganic As(III) inside cells, AQP9 plays a dual role in the detoxification of arsenic metabolites by facilitating efflux from cells. PMID: 19802720
  20. Coordinated regulation of fat-specific and liver-specific glycerol channels, aquaporin adipose and aquaporin 9. PMID: 12351427
  21. expression in a mucus-secreting goblet cell subset in the small intestine PMID: 12681500
  22. AQP9 has a role in osteoclast differentiation, specifically in the fusion process PMID: 16698796
  23. AQP9 is important for hepatic glycerol metabolism and may play a role in glycerol and glucose metabolism in diabetes mellitus. PMID: 17360690
  24. AQP9 is the major glycerol channel in mouse erythrocytes PMID: 17636116
  25. Results confirm that AQP9 expression rises during osteoclast biogenesis, but indicate that AQP9 is not essential for osteoclast function or differentiation under normal physiological conditions. PMID: 18666888
  26. The present data provide conclusive evidence for the presence of tetrameric AQP9 in brain and for the expression of AQP9 in neurons. PMID: 19115411
  27. Blockade of MAPK14/11 negated the increase in Aqp 3 and 9 mRNA levels, whereas culture in a MAPK8 blocker did not in preimplantation embryo PMID: 19258345
  28. In the present study, the contribution of AQP9 to the uptake of inorganic arsenite, thereby increasing arsenic-induced cytotoxicity in primary mouse hepatocytes, is reported. PMID: 19341753

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×