Recombinant Rat Aquaporin-3 (Aqp3)

Code CSB-CF001963RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Aqp3; Aquaporin-3; AQP-3; 31.4 kDa water channel protein; Aquaglyceroporin-3
Species
Rattus norvegicus (Rat)
Expression Region
1-292
Target Protein Sequence
MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLAILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWAFAGNELVVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGQNWWWVPIVSPLLGSIGGVFVYQLMIGCHLEQPPPSTEAENVKLAHMKHKEQI
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Water channel required to promote glycerol permeability and water transport across cell membranes. Acts as a glycerol transporter in skin and plays an important role in regulating SC (stratum corneum) and epidermal glycerol content. Involved in skin hydration, wound healing, and tumorigenesis. Provides kidney medullary collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Slightly permeable to urea and may function as a water and urea exit mechanism in antidiuresis in collecting duct cells. It may play an important role in gastrointestinal tract water transport and in glycerol metabolism.
Gene References into Functions
  1. Negative relationship between AQP-3 expression and activity of the p38 MAPK pathway in nucleus pulposus cells under oxidative damage showed that AQP-3 overexpression partly decreases the pathway's activity in nucleus pulposus cells of the same condition. PMID: 30384362
  2. The findings indicate that mRNA expression of AQP3 varies with age. PMID: 27525904
  3. Larger expression of AQP3 may confer to the cell a more tumor like phenotype and contributes to explain the presence of this protein in many different tumors. PMID: 26367709
  4. one of the functional mechanisms of intense pulsed light might be related to the regulation of AQP3 protein expression PMID: 26231231
  5. The results suggest that morphine increases the AQP3 expression level in the colon, which promotes water absorption from the luminal side to the vascular side and causes constipation. PMID: 25766885
  6. findings suggest that there may be a relationship between impaired AQP3 expression and diabetes-delayed reepithelialization. Thus, future nursing studies should focus on this mechanism in diabetic wound healing PMID: 22531364
  7. Expression of aquaporin 3 in the proximal colon of slow transit constipation rat models is down-regulated, which regulates water absorption. PMID: 21713710
  8. The present study found that AQP3 expression correlated with H. pylori infection status in gastric cancer tissues. PMID: 23152856
  9. TGF-beta1 induces AQP3 and that AQP3 has a critical role in TGF-beta-induced human peritoneal mesothelial cell migration. PMID: 23041062
  10. Protein expression of AQP3 was significantly lower after ovariectomy and was restored to the control levels after 17beta-estradiol treatment. This suggests that AQPs may have a role in detrusor overactivity that occurs with hormonal alteration in female rat. PMID: 21479884
  11. The fecal water content in the colon is controlled by the transport of water from the luminal side to the vascular side, which is mediated by AQP3. PMID: 22687538
  12. Report age-related changes in expression of renal AQP3 in response to congenital, partial, unilateral ureteral obstruction in rats. PMID: 22028046
  13. Report AQP3 up-regulation in the solitary kidney in response to partial ureteral obstruction in neonatal rats. PMID: 21677414
  14. AQP-3 expression was localized exclusively to the epididymis PMID: 15223838
  15. results suggest that aquaporin 3 is expressed not only in large airways, but also in bronchioles, and is related to water movement in pulmonary edema PMID: 15248066
  16. AQP3 was detected in the alveolar epithelium and duct system. PMID: 15844003
  17. The permeability of immature zebrafish oocytes to water and cryoprotectants was enhanced by exogenous expression of aquaporin-3. PMID: 17325454
  18. Discuss the role of AQP3 in TNF-alpha-mediated inflammation and the development of periodontitis. PMID: 18543247

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Tissue Specificity
Detected in kidney medulla and papilla, in collecting duct cells. Detected in colon.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1