Recombinant Rat Aquaporin-8 (Aqp8)

Code CSB-CF001972RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Aqp8
Uniprot No.
Alternative Names
Aqp8; Aquaporin-8; AQP-8
Species
Rattus norvegicus (Rat)
Expression Region
1-263
Target Protein Sequence
MSGEQTPMCSMDLREIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIENSPNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLFIGDEKTRLILKSR
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Forms a water-specific channel; mercury-sensitive. It may have an important role in spermatogenesis, in fertilization, and in the secretion of pancreatic juice and saliva.
Gene References into Functions
  1. in vitro and in vivo data suggest that hepatic mtAQP8 expression is downregulated in acidosis, a mechanism that may contribute to decreased ureagenesis from ammonia in response to acidosis PMID: 26194146
  2. Downregulation of hepatocyte mtAQP8 expression leads to defective ureagenesis from ammonia in lipopolysaccharide-treated rats. PMID: 24642373
  3. The results obtained here implied that both AQP3 and AQP8 may be involved in the pathogenesis of inflammatory bowel disease. PMID: 24286754
  4. Hepatocyte mtAQP8 channels facilitate the mitochondrial uptake of ammonia and its metabolism into urea, mainly under glucagon stimulation. PMID: 23299935
  5. AQP8 plays an important role in the adaptive response of proximal tubule to acidosis possibly facilitating mitochondrial ammonia transport PMID: 22622463
  6. Down-regulated AQP8 protein expression and up-regulated AQP8 mRNA expression in the hepatocytes of pregnant rats with intrahepatic cholestasis may contribute to the pathogenesis of intrahepatic cholestasis. PMID: 18683753
  7. increased in placental labyrinth zone in maternal undernutrition PMID: 20958229
  8. these data suggest that ammonia diffusional transport is a major function for mitochondrial AQP8. PMID: 20132793
  9. Involvement of aquaporin-8 in rat testis development and spermatogenesis. PMID: 11676488
  10. Immunolocalization in kidney and other organs PMID: 11704555
  11. The cellular and subcellular distribution of AQP8 suggest physiological roles for this aquaporin in the absorption of water in the intestine and the secretion of bile and pancreatic juice in liver and pancreas. PMID: 11824790
  12. Expression and localization of aquaporin water channels in rat hepatocytes. Evidence for a role in canalicular bile secretion. PMID: 11932260
  13. AQP-8 was expressed exclusively in Sertoli cells PMID: 12002438
  14. Defective expression of AQP8 water channels may contribute to bile secretory dysfunction of cholestatic hepatocytes. PMID: 12717383
  15. Glucagon induces protein kinase A and microtubule-dependent translocation of AQP8 water channels to hepatocyte canalicular plasma membrane, leading to increase in membrane water permeability. PMID: 12774023
  16. AQP8-mediated water transport may be particularly important for rapid expansions of mitochondrial volume such as those occurring during active oxidative phosphorylation and those following apoptotic signals PMID: 15749715
  17. aquaporin-8 may play a major role in water movement through the colon by acting on the apical side of the superficial cells PMID: 16177191
  18. AQP8 is expressed in the myoepithelial cells, but not in the acinar cells, of both the rat submandibular gland and parotid gland. PMID: 16311720
  19. A defective expression of canalicular AQP8 contributes as a mechanism for bile secretory dysfunction of cholestatic hepatocytes. PMID: 17110522
  20. electrically silent ammonia transport may be the main function of AQP8. PMID: 17189259
  21. Defective expression of hepatocyte AQP8 contributes to the development of bile secretory dysfunction in sepsis. PMID: 18662282
  22. Glucagon induces the gene expression of aquaporin-8 but not that of aquaporin-9 water channels in the rat hepatocyte. PMID: 19193945

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Tissue Specificity
Highly expressed in sperm, pancreas and liver. Some expression has been found in salivary gland and absorptive colonic epithelial cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×