Recombinant Mouse Fibroblast growth factor 1(Fgf1) (Active)


In Stock
Code CSB-AP004151MO
Product Type Growth Factor
Size $65Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P61148
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 500 mM NaCl, pH 6.6
Alias Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Heparin-Binding Growth Factor 1; HBGF-1; Fgf1; Fgf-1; Fgfa
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of Heparin is less than 1.6 ng/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Research Area Signal Transduction
Source E.coli
Gene Names Fgf1
Expression Region 16-155aa
Tag Info Tag-Free
Mol. Weight 15.7 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV
Subcellular Location Secreted, Cytoplasm, Cytoplasm, cell cortex, Cytoplasm, cytosol, Nucleus
Protein Families Heparin-binding growth factors family
Database Links

KEGG: mmu:14164

STRING: 10090.ENSMUSP00000045710

UniGene: Mm.241282

Pathway Hippo signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Rap1 signaling pathway

Related Products

Fgf1 Antibodies

Fgf1 Antibodies for Mus musculus (Mouse)

Fgf1 Antibodies for Mouse

Fgf1 Proteins

Fgf1 Proteins for Mus musculus (Mouse)

Fgf1 ELISA Kit

Fgf1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.