Recombinant Human Interleukin-36 gamma(IL36G)

In Stock
Code CSB-AP004561HU
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q9NZH8
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0
Alias Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is less than 20 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Research Area Immunology
Source E.coli
Gene Names IL36G
Expression Region 18-169aa
Tag Info Tag-Free
Mol. Weight 17 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation
Subcellular Location Secreted
Protein Families IL-1 family
Tissue Specificity Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional ps
Database Links

HGNC: 15741

OMIM: 605542

KEGG: hsa:56300

STRING: 9606.ENSP00000259205

UniGene: Hs.211238

Related Products

IL36G Antibodies

IL36G Antibodies for Human

IL36G Proteins

IL36G Proteins for Homo sapiens (Human)

IL36G ELISA Kit

IL36G ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.