Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004561HU |
| Product Type | Interleukin |
| Size |
$195Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | Q9NZH8 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0 |
| Alias | Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1 |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is less than 20 ng/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
| Research Area | Immunology |
| Source | E.coli |
| Gene Names | IL36G |
| Expression Region | 18-169aa |
| Tag Info | Tag-Free |
| Mol. Weight | 17 kDa |
| Protein Description | Full Length of Mature Protein |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation |
| Subcellular Location | Secreted |
| Protein Families | IL-1 family |
| Tissue Specificity | Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional ps |
| Database Links |
HGNC: 15741 OMIM: 605542 KEGG: hsa:56300 STRING: 9606.ENSP00000259205 UniGene: Hs.211238 |
IL36G Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA873706ESR1HU | IL36G Antibody | Human | ELISA, IHC |
| CSB-PA873706ESR2HU | IL36G Antibody | Human | ELISA, IHC |
IL36G Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP873706HU CSB-BP873706HU CSB-MP873706HU |
Recombinant Human Interleukin-36 gamma(IL36G) | Yeast Baculovirus Mammalian cell |
| CSB-AP002041HU | Recombinant Human Interleukin-36 gamma protein(IL36G) (Active) | E.coli |
| CSB-AP002031HU | Recombinant Human Interleukin-36 gamma protein(IL36G) (Active) | E.coli |
| CSB-EP873706HU | Recombinant Human Interleukin-36 gamma(IL36G) | E.coli |
IL36G ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL011620HU | Human Interleukin-36 gamma(IL1F9) ELISA kit | serum, plasma, cell culture supernates, tissue homogenates | 19.5 pg/mL |
Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Junctional adhesion molecule B(JAM2),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Transcription elongation factor SPT4(SUPT4H1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Coagulation factor VII(F7),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Glutathione S-transferase A2(GSTA2)
Express system: E.coli
Species: Homo sapiens (Human)
