Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IL36G

Uniprot No.

Q9NZH8

Research Area

Immunology

Alternative Names

IL 1 epsilon; IL 1 related protein 2; IL 1(EPSILON); IL 1F9; IL 1H1; IL 1RP2; IL-1 epsilon; IL-1-related protein 2; IL-1F9; IL-1H1; IL-1RP2; IL1E; Il1f9; IL1F9_HUMAN; IL1H1; IL1RP2; IL36 gamma; IL36G; Interleukin 1 epsilon; Interleukin 1 family member 9; Interleukin 1 homolog 1; Interleukin 1 related protein 2; Interleukin 36 gamma; Interleukin-1 epsilon; Interleukin-1 family member 9; Interleukin-1 homolog 1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-169aa

Target Protein Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

45.7kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation: activates mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts, and stimulates the expression of IL-8 and CXCL3 and Th17 chemokine CCL20 in lung fibroblasts. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus.

Gene References into Functions

serum IL-36gamma levels were higher in active systemic lupus erythematosus patients and correlated with disease activity and arthritis PMID: 29571080
Cathepsin S was identified as the major IL-36gamma-activating protease expressed in epithelial cells. PMID: 28289191
enhanced expression of IL-36gamma was observed in plasma and bronchoalveolar lavage fluid of patients with acute respiratory distress syndrome because of bacterial pneumonia PMID: 28176791
IL-36-mediated IL-6 and CXCL8 production in human lung fibroblasts and bronchial epithelial cells may be involved in pulmonary inflammation especially caused by bacterial or viral infections. PMID: 28869889
With a focus on the skin as a target for microbial and viral invasion, the current knowledge of IL-36: IL-36alpha, IL-36beta and IL-36gamma, functions is reviewed. One physiological function of the IL-36smay be to counteract microbial immune evasion. [Review] PMID: 28811383
IL-36gamma inhibits differentiation and induces inflammation of keratinocyte via Wnt signaling pathway in psoriasis. PMID: 28924372
IL-36gamma-stimulated endothelial cells secrete the proinflammatory chemokines IL-8, CCL2 and CCL20. PMID: 27673278
skin injury increases IL-36gamma via the activation of TLR3-SLUG-VDR axis and IL-36gamma induces REG3A to promote wound healing PMID: 28774595
Autocrine and Paracrine Regulation of Keratinocyte Proliferation through a Novel Nrf2-IL-36gamma Pathway PMID: 27183581
Here the authors show that Mycobacterium tuberculosis infection of macrophages induces IL-36gamma production in a 2-stage-regulated fashion. PMID: 27389350
IL-36gamma, a member of the IL-1 superfamily, is involved in host defense and contributes to proinflammatory responses and development of inflammatory diseases. PMID: 27853811
IL-36gamma is significantly more strongly expressed in the epidermis of patients with psoriasis-based erythroderma than in other inflammatory skin diseases. PMID: 26524325
Study shows that plasma concentrations of IL-36alpha and IL-36gamma are overexpressed in active systemic lupus erythematosus patients and that IL-36alpha has a substantial pro-inflammatory effect through regulation of IL-6 and CXCL8 production. PMID: 26516833
IRF6 is likely to promote inflammation to P. gingivalis through its regulation of IL-36gamma. PMID: 26819203
Findings indicate that Interleukin (IL)-1beta-induced interleukin 36 gamma (IL-36gamma) expression is mediated by the activation of transcriptional factors, NF-kappaB p65 and AP-1 (c-jun). PMID: 26562662
IL36G was identified as strong regulators of skin pathology in both lesional and non-lesional skin samples. PMID: 25897967
Decreased Langerhans cell responses to IL36G: altered innate immunity in patients with recurrent respiratory papillomatosis PMID: 24950037
IL-36gamma expression inversely correlated with the progression of human melanoma and lung cancer. PMID: 26321222
IL-36gamma is a valuable biomarker in psoriasis patients, both for diagnostic purposes and measurement of disease activity during the clinical course PMID: 25525775
CAMP induces IL-36gamma expression leading to initiation of skin inflammation and occasional exacerbations of psoriasis. PMID: 25305315
IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin PMID: 24829417
This is the first report of extracellular release of endogenous IL-36gamma through pyroptosis suggesting a function of IL-36gamma as an alarmin. PMID: 22318382
Data presented herein shed further light on involvement of T-bet in innate immunity and suggest that IL-36gamma, besides IFNgamma, may contribute to functions of this transcription factor in immunopathology. PMID: 23095752
Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra) activity PMID: 21965679
Regulation and function of the IL-1 family cytokine IL-1F9 in human bronchial epithelial cells. PMID: 20870894
Expression of IL-1F9 is increased in human plaque psoriasis skin and is overexpressed in a transgenic mouse psoriasis model. PMID: 21242515
IL-1F6 and IL-1F8, in addition to IL-1F9, activate the pathway leading to NF-kappaB in an IL-1Rrp2-dependent manner in Jurkat cells PMID: 14734551
This is the first report of IL-1 genotype association with the inflammation of skeletal muscle following acute resistance exercise that may potentially affect the adaptations to chronic resistance exercise. PMID: 15331687
This report demonstrates expression of IL1F9 by bronchial epithelial cells induced by pro-inflammatory stimuli, suggesting a function of this molecule in airway inflammation. PMID: 15701729

Hide All

Subcellular Location

Cytoplasm. Secreted.

Protein Families

IL-1 family

Tissue Specificity

Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional ps

Database Links

HGNC: 15741

OMIM: 605542

KEGG: hsa:56300

STRING: 9606.ENSP00000259205

UniGene: Hs.211238

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP873706HU
MSDS	MSDS
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP873706HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL36G. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP873706HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL36G.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interleukin-36 gamma (IL36G)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage