Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active)

Code CSB-EP303998ENV
Product Type Other
Size Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P69506
Relevance Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 μg/ml can bind human ytfE, the EC50 of human ytfE protein is 197.90-259.70 μg/ml.
Storage Buffer Tris-based buffer,50% glycerol
Alias Regulator of cell morphogenesis and NO signaling
Species Escherichia coli (strain K12)
Biological_Activity Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 μg/ml can bind human ytfE, the EC50 of human ytfE protein is 197.90-259.70 μg/ml.
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
Research Area Others
Source E.coli
Gene Names ytfE
Expression Region 1-220aa
Tag Info N-terminal GST-tagged
Mol. Weight 51.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.
Subcellular Location Cytoplasm
Protein Families RIC family, YtfE subfamily
Database Links

KEGG: ecj:JW4167

STRING: 316385.ECDH10B_4404

Related Products

ytfE Antibodies

ytfE Antibodies for Escherichia coli (strain K12)

ytfE Proteins

ytfE Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.