Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) (Active)

In Stock
Code CSB-EP303998ENV
Abbreviation Recombinant E.coli YTFE protein (Active)
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 μg/ml can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 μg/ml.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 μg/ml can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 μg/ml.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
ytfE; b4209; JW4167; Iron-sulfur cluster repair protein YtfE; Regulator of cell morphogenesis and NO signaling; RCMNS
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
1-220aa
Target Protein Sequence
MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
Mol. Weight
51.9kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.
Gene References into Functions
  1. Escherichia coli RIC is able to donate iron to iron-sulfur clusters. PMID: 24740378
  2. The authors confirm that YtfE is required to repair damage to iron-sulfur centres and for hydrogen peroxide resistance. PMID: 20138195
Subcellular Location
Cytoplasm.
Protein Families
RIC family, YtfE subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*