Recombinant Human Ephrin type-A receptor 3 (EPHA3), partial (Active)

In Stock Promotion
Code CSB-MP007723HU
Abbreviation Recombinant Human EPHA3 protein, partial (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5(CSB-MP007464HU), the EC50 of the protein is 0.9734-1.179 ng/ml.

    Biological Activity Assay

  • Activity
    Human EPHA3 protein his tag (CSB-MP007723HU) captured on COOH chip can bind Human EFNA5 protein Fc tag (CSB-MP007464HU) with an affinity constant of 13.8 nM as detected by LSPR Assay. Biological Activity Assay

  • The purity of Human EPHA3 was greater than 95% as determined by SEC-HPLC

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5(CSB-MP007464HU), the EC50 of the protein is 0.9734-1.179 ng/ml. ②Human EPHA3 protein his tag (CSB-MP007723HU) captured on COOH chip can bind Human EFNA5 protein Fc tag (CSB-MP007464HU) with an affinity constant of 13.8 nM as detected by LSPR Assay.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
AW492086; Cek4; EC 2.7.10.1; EK4; End3; Eph receptor A3; EPH-like kinase 4; EPH-like tyrosine kinase 1; EPHA3; EPHA3_HUMAN; Ephrin receptor EphA3; Ephrin type-A receptor 3; ETK 1; ETK; ETK1; HEK 4; HEK; HEK4; Human embryo kinase 1; Human embryo kinase; Mek4; MGC109882; Receptor tyrosine kinase HEK; Testicular tissue protein Li 64; Tyro 4; Tyro4; TYRO4 protein tyrosine kinase; Tyrosine protein kinase receptor ETK 1; Tyrosine-protein kinase receptor ETK1; Tyrosine-protein kinase TYRO4
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-541aa
Target Protein Sequence
ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ
Mol. Weight
61.0 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

EPHA3 plays a critical role in axon guidance and tumor angiogenesis, making its extracellular domain a key target for oncology-focused drug discovery and therapeutic antibody development. This recombinant construct spans residues 21–541, covering the ligand-binding and cysteine-rich domains, and is expressed in mammalian cells to preserve native glycosylation and disulfide-mediated folding essential for conformational integrity. Functional ELISA confirms that immobilized EPHA3 binds human EFNA5 with an EC50 of 0.97–1.18 ng/ml, providing validated support for receptor-ligand interaction assays, competitive inhibition studies, blocking antibody screening, and small-molecule inhibitor discovery campaigns. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for SPR- or BLI-based affinity characterization and epitope mapping workflows where low background and consistent binding kinetics are essential.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
4.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: I used the product CSB-MP007723HU for an ELISA experiment, and the EC50 was 0.8674-1.119 ng/ml, which showed the protein has good binding activity. We subsequently used this protein product for ELISA and surface plasmon resonance, and the experimental results were good, the standard curve had good linearity, and the repeatability was good, which was in line with our expectations.

By Anonymous

Target Background

Function
Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development.
Gene References into Functions
  1. High EPHA3 expression is associated with tumor growth and angiogenesis in gastric cancer. PMID: 30066881
  2. To investigate the relationship between five EPHA3 single nucleotide polymorphisms (SNPs) and Nonsyndromic Cleft Lip With or Without Cleft Palate (NSCL/P), EPHA3 SNPs (rs7650466, rs1398197, rs17801309, rs1054750, and rs7632427) were genotyped. The rs7650466 T allele was associated with the incidence of NSCL/P as well as with protective and dominant effects in both conditions. PMID: 29932736
  3. Although EPHA3 was reported to be one of the most frequently mutated genes in colorectal tumors, our studies using inducible isogenic cell line systems, mouse models and large human tumor collections, did not reveal a major role of this EPH receptor on proliferation/motility/invasion of cancer cells, tumor initiation/progression/metastasis in mouse models or survival of colorectal cancer patients. PMID: 28169277
  4. The interaction of AR and SP1 contributes to regulate EPHA3 expression. PMID: 29917167
  5. Findings suggest that EPH receptor A3 (EphA3) plays an important role in the pathogenesis of multiple myeloma (MM). PMID: 28721629
  6. Study shows that EphA3 is highly overexpressed in multiple myeloma (MM) and provides evidence that EphA3 plays an important role in MM angiogenesis. PMID: 28415715
  7. Results indicate that EphA3 protein expression is reduced in clear-cell renal cell carcinoma, suggesting the possibility that this receptor functions as a tumor suppressor in this disease. PMID: 27591824
  8. EphA3 promotes malignant transformation of colorectal epithelial cells by upregulating oncogenic signaling pathways. PMID: 27721017
  9. Data indicate that EPHA3 is involved in regulating the multidrug resistance (MDR) of small cell lung cancer (SCLC) via PI3K/BMX/STAT3 signaling and may be a therapeutic target in SCLC. PMID: 27101199
  10. PTP-PEST regulates EphA3 activation both by affecting cytoskeletal remodelling and through its direct action as a PTP controlling EphA3 phosphorylation. PMID: 26644181
  11. This study showed that EPHA3 gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders. PMID: 26381449
  12. A novel association between the EPHA3 deletion and prostate cancer risk was observed in Finnish individuals. PMID: 26552734
  13. EphA3 forms dimers in the absence of ligand binding. PMID: 26232493
  14. Data indicate that hypoxia increased EphA3 receptor (EphA3) mRNA expression in EphA3+ endometrial multipotent mesenchymal stromal cells (eMSCs). PMID: 25420155
  15. EphA3 was induced by PC-1 and contributed to the malignant progression of prostate cancer PMID: 25231727
  16. Based on the knowledge that EPHA4 has been previously shown to rescue SOD1 transgenic mice from ALS phenotype and prolongs survival, EPHA3 may be a promising candidate for therepuetic interventions PMID: 23991104
  17. EphA3 may represent a novel candidate marker for patient prognosis as well a molecular target for HCC therapy. PMID: 23970317
  18. EPHA3 mutations may promote tumorigenesis only when key senescence-inducing pathways have been inactivated. PMID: 23324396
  19. EphA3 may play important roles in the angiogenesis and prognosis of gastric carcinoma PMID: 22350700
  20. High EphA3 expression is associated with glioblastoma multiforme. PMID: 23410976
  21. Cancer-associated EPHA3 mutations attenuate the tumor-suppressive effects of normal EPHA3 in lung cancer. PMID: 22829656
  22. EphA3 has ephrin- and kinase-dependent tumor suppressing activities, which are disrupted by somatic cancer mutations PMID: 22242939
  23. expression of EphA3 and CD133 in carcinoma was significantly higher than that in normal mucosal tissue PMID: 21415057
  24. Experiments in EphA3/Isl2 knock-in mice test the interactions between effects of molecular labels and correlated activity during the development of neural connectivity. PMID: 21190559
  25. Authors found significant association between the copy number variations of EphA3 and hematologic malignancies. PMID: 21454190
  26. Data shew that the identification of three novel candidates as EPH receptor genes might indicate a link between perturbed compartmentalization of early neoplastic lesions and breast cancer risk and progression. PMID: 21124932
  27. Data provide further support that ALS2CL, EPHA3, and CMYA1 are bona-fide tumor-suppressor genes and contribute to the tumorigenesis of HNSCC. PMID: 20657180
  28. EphA3, was identified as a new CD28-responsive gene in Jurkat cells by using a human cytokine/receptor array. EphA3 expression in CD28-stimulated Jurkat cells was enhanced by IGF-1 or by overexpression of the IGF-1R. PMID: 14697337
  29. Results show EPHA3 gene was implicated in the pathogenesis of lung cancer and it may be useful targets for diagnostic and therapeutic intervention in selected patients. PMID: 16941478
  30. High-resolution structures of the EphA3 kinase with and without the juxtamembrane segment allowed mapping of the coupled pathway of residues that connect the juxtamembrane segment, the activation loop, and the catalytic residues of the kinase domain. PMID: 18547520
  31. EphA3 expression may define subsets of rhabdomyosarcoma tumours, and that EphA3 suppresses motility through regulation of Rho GTPases in rhabdomyosarcoma cells. PMID: 18814179
  32. D219V missense mutation in EPHA3 is associated with hepatocellular carcinoma. PMID: 19469653
  33. mechanism of substrate binding PMID: 19678838

Show More

Hide All

Involvement in disease
Colorectal cancer (CRC)
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
Tissue Specificity
Widely expressed. Highest level in placenta.
Database Links

HGNC: 3387

OMIM: 114500

KEGG: hsa:2042

STRING: 9606.ENSP00000337451

UniGene: Hs.123642

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*