Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-MP007723HU |
 |
|
| Product Type | Other |
| Size | |
| Uniprot No. | P29320 |
| Relevance | Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development. |
| Image |
|
| Molecular Characterization |  |
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Alias | EPH-like kinase 4 (EK4) (hEK4) (HEK) (Human embryo kinase) (Tyrosine-protein kinase TYRO4) (Tyrosine-protein kinase receptor ETK1) (Eph-like tyrosine kinase 1) (ETK) (ETK1) (TYRO4) |
| Species | Homo sapiens (Human) |
| Biological_Activity | Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5(CSB-MP007464HU), the EC50 of the protein is 0.9734-1.179 ng/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Sequence | ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ |
| Research Area | Cancer |
| Source | Mammalian cell |
| Gene Names | EPHA3 |
| Expression Region | 21-541aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 61.0 kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development. |
| Involvement in disease | Colorectal cancer (CRC) |
| Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted |
| Protein Families | Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily |
| Tissue Specificity | Widely expressed. Highest level in placenta. |
| Database Links |
HGNC: 3387 OMIM: 114500 KEGG: hsa:2042 STRING: 9606.ENSP00000337451 UniGene: Hs.123642 |
EPHA3 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA159480 | Phospho-EPHA3 (Tyr779/833) Antibody | Human,Mouse,Rat | ELISA,IHC |
| CSB-PA030077 | EPHA3 (Ab-602) Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA298527 | EPHA3 Antibody | Human | ELISA,WB |
| CSB-PA008057 | EPHA3 Antibody | Human,Mouse,Rat | WB,ELISA |
| CSB-PA008060 | EPHA3 Antibody | Human,Mouse,Rat | WB,ELISA |
EPHA3 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP007723HU CSB-EP007723HU CSB-BP007723HU |
Recombinant Human Ephrin type-A receptor 3(EPHA3),partial | Yeast E.coli Baculovirus |
Recombinant Mouse Lysyl oxidase homolog 1(Loxl1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Guanine nucleotide-binding protein subunit alpha-15(GNA15)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Metallothionein-1F(MT1F),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Receptor-type tyrosine-protein phosphatase C(PTPRC),partial
Express system: Yeast
Species: Homo sapiens (Human)
