Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5(CSB-MP007464HU), the EC50 of the protein is 0.9734-1.179 ng/ml. ②Human EPHA3 protein his tag (CSB-MP007723HU) captured on COOH chip can bind Human EFNA5 protein Fc tag (CSB-MP007464HU) with an affinity constant of 13.8 nM as detected by LSPR Assay.
Alternative Names
AW492086; Cek4; EC 2.7.10.1; EK4; End3; Eph receptor A3; EPH-like kinase 4; EPH-like tyrosine kinase 1; EPHA3; EPHA3_HUMAN; Ephrin receptor EphA3; Ephrin type-A receptor 3; ETK 1; ETK; ETK1; HEK 4; HEK; HEK4; Human embryo kinase 1; Human embryo kinase; Mek4; MGC109882; Receptor tyrosine kinase HEK; Testicular tissue protein Li 64; Tyro 4; Tyro4; TYRO4 protein tyrosine kinase; Tyrosine protein kinase receptor ETK 1; Tyrosine-protein kinase receptor ETK1; Tyrosine-protein kinase TYRO4
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
21-541aa
Target Protein Sequence
ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The Human Ephrin Type-A receptor 3 (EPHA3) is a membrane tyrosine kinase receptor that promiscuously binds to ephrin family ligands. EPHA3 participates in migration and cell adhesion processes, thus mediating in the mesenchymal transition and the focal adhesion assembly. So it’s a known oncogene for colorectal cancer. This recombinant protein is expressed in mammalian cells and fused with a 6xHis-tag on the C-terminus. The expressed region is the 21-541aa of the human EPHA3 protein, with a molecular weight of 61 kDa. The purity of the final product is higher than 95%, as determined by SDS-PAGE. The biophysical parameters of this recombinant protein were tested with ELISA and LSPR. In the functional ELISA, this recombinant protein has an EC50 of 0.9734-1.179 ng/ml for the binding with human EFNA5. LSPR determines the affinity constant for the binding with human EFNA5 is 13.8 nM. This protein product can be used in ELISA and Surface Plasmon Resonance to determine the presence and concentrations of their ligands in the sample and as a control for ligand binding assays. It also can be used as an immunogen to immunize the rabbit or other animals to get corresponding antibodies and is applied to immunological studies related to immune response pathways. The final product has low levels of endotoxin, with less than 1.0 EU/µg as determined by the LAL method.