Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP017802HU |
| Product Type | Other |
| Size |
US$1726Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P40855 |
| Relevance | Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53. |
| Image |
|
| Storage Buffer | Tris-based buffer，50% glycerol |
| Alias | 33 kDa housekeeping protein Peroxin-19 Peroxisomal farnesylated protein |
| Species | Homo sapiens (Human) |
| Biological_Activity | Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC50 of human PEX19 protein is 22.96-33.00 μg/ml. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC |
| Research Area | Tags & Cell Markers |
| Source | E.coli |
| Gene Names | PEX19 |
| Expression Region | 2-296aa |
| Tag Info | N-terminal GST-tagged |
| Mol. Weight | 59.3kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53. |
| Involvement in disease | Peroxisome biogenesis disorder complementation group 14 (PBD-CG14); Peroxisome biogenesis disorder 12A (PBD12A) |
| Subcellular Location | Cytoplasm, Peroxisome membrane, Lipid-anchor, Cytoplasmic side |
| Protein Families | Peroxin-19 family |
| Tissue Specificity | Ubiquitously expressed. Isoform 1 is strongly predominant in all tissues except in utero where isoform 2 is the main form. |
| Database Links |
HGNC: 9713 OMIM: 600279 KEGG: hsa:5824 STRING: 9606.ENSP00000357051 UniGene: Hs.517232 |
PEX19 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA017802GA01HU | PEX19 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA040121 | PEX19 Antibody | Human | WB,IHC,ELISA |
PEX19 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA017802DSR2HU | PEX19 Antibody | Human | ELISA, IHC |
PEX19 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP017802HU CSB-EP017802HU CSB-BP017802HU CSB-MP017802HU |
Recombinant Human Peroxisomal biogenesis factor 19(PEX19) | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse L-dopachrome tautomerase(Dct),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human DNA-3-methyladenine glycosylase(MPG),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Macaca mulatta Interleukin-10(IL10)
Express system: Yeast
Species: Macaca mulatta (Rhesus macaque)
Recombinant Human Phospholipid transfer protein(PLTP)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Sulfotransferase family cytosolic 1B member 1(Sult1b1)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Mouse Lysyl oxidase homolog 2(Loxl2)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp)
Express system: E.coli
Species: Mus musculus (Mouse)
