Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC50 of human PEX19 protein is 22.96-33.00 μg/ml.

Target Names

PEX19

Uniprot No.

P40855

Research Area

Tags & Cell Markers

Alternative Names

33 kDa housekeeping protein; D1S2223E; HK33; Housekeeping gene 33kD; OK/SW-cl.22; PBD12A; Peroxin 19; Peroxin-19; Peroxisomal biogenesis factor 19; Peroxisomal farnesylated protein; PEX19; PEX19_HUMAN; PMP1; PMPI; PXF; PXMP1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-296aa

Target Protein Sequence

AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC

Mol. Weight

59.3kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Human PEX19 is a full-length mature protein corresponding to the 2-296aa expression region of Peroxisomal biogenesis factor 19, an important component in research focused on tags and cell markers. Produced in E. coli, this N-terminal GST-tagged protein demonstrates a purity greater than 90% as determined by SDS-PAGE. Its activity is measured by a functional ELISA, in which immobilized ABCD1 at 5 μg/mL can bind human PEX19 with an EC₅₀ of 22.96-33.00 μg/mL. The product is supplied as a lyophilized powder, enabling convenient storage and use in a variety of research applications.

Target Background

Function

Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.

Gene References into Functions

Thus, PEX19 and PEX3 peroxisome biogenesis factors provide an alternative posttranslational route for membrane insertion of the reticulon homology domain-containing proteins, implying that endoplasmic reticulum membrane shaping and peroxisome biogenesis may be coordinated. PMID: 29396426
The results demonstrate an allosteric mechanism for the modulation of PEX19 function by farnesylation. PMID: 28281558
that newly synthesized UBXD8 is post-translationally inserted into discrete ER subdomains by a mechanism requiring cytosolic PEX19 and membrane-integrated PEX3, proteins hitherto exclusively implicated in peroxisome biogenesis PMID: 27295553
suggest a novel regulatory mechanism for peroxisome biogenesis through the interaction between Pex19p and PLA/AT-3 PMID: 26018079
Thus within the cell, PEX3 is stabilized by PEX19 preventing PEX3 aggregation. PMID: 25062251
PEX19 formed a complex with the peroxisomal tail anchored protein PEX26 in the cytosol and translocated it directly to peroxisomes by a TRC40-independent class I pathway. PMID: 23460677
PEX3-PEX19 interaction is crucial for de novo formation of peroxisomes in peroxisome-deficient cells. PMID: 22624858
The Pex19p peptide contains a characteristic motif, consisting of the leucine triad (Leu18, Leu21, Leu22), and Phe29, which are critical for the Pex3p binding and peroxisome biogenesis. PMID: 21102411
The crystal structure of the cytosolic domain of PEX3 in complex with a PEX19-derived peptide. PEX3 adopts a novel fold that is best described as a large helical bundle. PMID: 20554521
data indicate a divided N-terminal and C-terminal structural arrangement in Pex19p, which is reminiscent of a similar division in the Pex5p receptor, to allow separation of cargo-targeting signal recognition and additional functions. PMID: 20531392
a considerable functional diversity of the proteins encoded by two PEX19 splice variants and thereby provide first experimental evidence for specific biological functions of the different predicted domains of the PEX19 protein. PMID: 11883941
PEX19 binds and stabilizes newly synthesized PMPs in the cytosol, binds to multiple PMP targeting signals (mPTSs), interacts with the hydrophobic domains of PMP targeting signals, and is essential for PMP targeting and import. PMID: 14709540
Interaction of PEX3 and PEX19 visualized by fluorescence resonance energy transfer (FRET). PMID: 14713233
Pex19p has a role in assembly of PTS-receptor docking complexes PMID: 14715663
Results suggest that PEX3 plays a selective, essential, and direct role in class I peroxisomal membrane protein import as a docking factor for PEX19. PMID: 15007061
human Pex19p domain architecture and activity PMID: 15252024
analysis of the PEX19-binding site of human adrenoleukodystrophy protein PMID: 15781447
Pex19p translocates the membrane peroxins from the cytosol to peroxisomes in an ATP- and Pex3p-dependent manner and then shuttles back to the cytosol PMID: 16280322
Pex19p binds to PMP70 co-translationally and keeps PMP70 in a proper conformation for the localization to peroxisome. PMID: 16344115
Nonfarnesylated and farnesylated human Pex19p display a similar affinity towards a select set of peroxisomal membrane proteins. PMID: 16791427
Data suggest that Pex19p probably functions as a chaperone for membrane proteins and transports them to peroxisomes by anchoring to Pex3p using residues 12-73 and 40-131. PMID: 16895967
either one or two tryptophan residues of Pex3p (Trp-104 and Trp-224) are directly involved in binding to Pex19p. PMID: 18174172
targeting of hFis1 to peroxisomes and mitochondria are independent events and support a direct, Pex19p-dependent targeting of peroxisomal tail-anchored proteins. PMID: 18782765
N-terminal domain of Pex14, Pex14(N), adopts a three-helical fold. Pex5 and Pex19 ligand helices bind competitively to the same surface in Pex14(N) albeit with opposite directionality. PMID: 19197237
ALDRP interacts with PEX19 splice variants PEX19-delta-E2 and PEX19-delta-E8. PMID: 11883941
LDRP (ABCD2) interacts with both farnesylated wild-type and farnesylation-deficient mutant PEX19. This interaction is mediated by amino acids 1-218 of ALDRP. PMID: 10777694
MP70 (ABCD3) interacts with both farnesylated wild-type and farnesylation-deficient mutant PEX19. PMID: 10777694
MP70 interacts with PEX19 splice variants PEX19-delta-E2 and PEX19p-delta-E8. PMID: 11883941

Hide All

Involvement in disease

Peroxisome biogenesis disorder complementation group 14 (PBD-CG14); Peroxisome biogenesis disorder 12A (PBD12A)

Subcellular Location

Cytoplasm. Peroxisome membrane; Lipid-anchor; Cytoplasmic side.

Protein Families

Peroxin-19 family

Tissue Specificity

Ubiquitously expressed. Isoform 1 is strongly predominant in all tissues except in utero where isoform 2 is the main form.

Database Links

HGNC: 9713

OMIM: 600279

KEGG: hsa:5824

STRING: 9606.ENSP00000357051

UniGene: Hs.517232

Code	CSB-EP017802HU
Abbreviation	Recombinant Human PEX19 protein (Active)
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC₅₀ of human PEX19 is 22.96-33.00 μg/ml.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage