Recombinant Human Regulator of G-protein signaling 17(RGS17) (Active)

Code CSB-EP019648HU
Size US$2062Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 μg/ml can bind human RGS17, the EC50 of human RGS17 protein is 31.63-34.44 μg/ml.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 μg/ml can bind human RGS17, the EC50 of human RGS17 protein is 31.63-34.44 μg/ml.
Target Names RGS17
Uniprot No. Q9UGC6
Research Area Signal Transduction
Alternative Names hRGS17; Regulator of G protein signalling 17; Regulator of G protein signalling Z2; Regulator of G-protein signaling 17; RGS-17; RGS17; RGS17_HUMAN; RGSZ2
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-210aa
Target Protein Sequence MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Mol. Weight 51.4 kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer,50% glycerol
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form
Gene References into Functions
  1. data suggest that RGS17 is overexpressed in colorectal carcinoma and promotes cell proliferation, migration, and invasion PMID: 28337960
  2. Results showed that RGS17 overexpression promoted hepatocarcinoma (HCC) cell proliferation, migration, and invasion, and reversed the miR-199 mediated inhibition of proliferation, migration, and invasion. PMID: 29559347
  3. Taken together, the results suggested that expression of miR-203 inhibited non-small-cell lung cancer tumor growth and metastasis by targeting RGS17 PMID: 28921827
  4. Variation in RGS17 was associated with risk for substance dependence diagnoses in both African American and European American populations. PMID: 22591552
  5. Two single nucleotide polymorphisms in the regulator of G-protein signaling 17 gene are associated with smoking initiation. PMID: 22006218
  6. RGS17 is differentially expressed in hepatocellular carcinoma cells and plays a central role in regulating transformed hepatocyte tumorgenicity. PMID: 21620966
  7. Results establish RGS10 and RGS17 as novel regulators of cell survival and chemoresistance in ovarian cancer cells and suggest that their reduced expression may be diagnostic of chemoresistance. PMID: 21044322
  8. Taken together, these data have provided the first evidence of miRNA regulation of RGS17 expression in lung cancer. PMID: 20420807
  9. RGS17 is a new RZ member that preferentially inhibits receptor signaling via G(i/o), G(z), and G(q) over G(s) to enhance cAMP-dependent signaling and inhibit calcium signaling PMID: 15096504
  10. RGS17, an overexpressed gene in human lung and prostate cancer, induces tumor cell proliferation through the cyclic AMP-PKA-CREB pathway. PMID: 19244110
  11. RGS17 is a major candidate for the familial lung cancer susceptibility locus on chromosome 6q23-25. PMID: 19351763

Show More

Hide All

Subcellular Location Membrane, Cell junction, synapse, synaptosome, Nucleus, Cytoplasm
Tissue Specificity Predominantly expressed in the cerebellum. Also expressed in the cortex and medulla. Weakly expressed in a number of peripheral tissues notably spleen, lung and leukocytes.
Database Links

HGNC: 14088

OMIM: 607191

KEGG: hsa:26575

STRING: 9606.ENSP00000206262

UniGene: Hs.166313

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1