Recombinant Human Regulator of G-protein signaling 17 (RGS17)

In Stock
Code CSB-EP019648HU
Abbreviation Recombinant Human RGS17 protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 μg/ml can bind human RGS17, the EC50 of human RGS17 protein is 31.63-34.44 μg/ml.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
hRGS17; Regulator of G protein signalling 17; Regulator of G protein signalling Z2; Regulator of G-protein signaling 17; RGS-17; RGS17; RGS17_HUMAN; RGSZ2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-210aa
Target Protein Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.4 kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Binds selectively to GNAZ and GNAI2 subunits, accelerates their GTPase activity and regulates their signaling activities. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
Gene References into Functions
  1. data suggest that RGS17 is overexpressed in colorectal carcinoma and promotes cell proliferation, migration, and invasion PMID: 28337960
  2. Results showed that RGS17 overexpression promoted hepatocarcinoma (HCC) cell proliferation, migration, and invasion, and reversed the miR-199 mediated inhibition of proliferation, migration, and invasion. PMID: 29559347
  3. Taken together, the results suggested that expression of miR-203 inhibited non-small-cell lung cancer tumor growth and metastasis by targeting RGS17 PMID: 28921827
  4. Variation in RGS17 was associated with risk for substance dependence diagnoses in both African American and European American populations. PMID: 22591552
  5. Two single nucleotide polymorphisms in the regulator of G-protein signaling 17 gene are associated with smoking initiation. PMID: 22006218
  6. RGS17 is differentially expressed in hepatocellular carcinoma cells and plays a central role in regulating transformed hepatocyte tumorgenicity. PMID: 21620966
  7. Results establish RGS10 and RGS17 as novel regulators of cell survival and chemoresistance in ovarian cancer cells and suggest that their reduced expression may be diagnostic of chemoresistance. PMID: 21044322
  8. Taken together, these data have provided the first evidence of miRNA regulation of RGS17 expression in lung cancer. PMID: 20420807
  9. RGS17 is a new RZ member that preferentially inhibits receptor signaling via G(i/o), G(z), and G(q) over G(s) to enhance cAMP-dependent signaling and inhibit calcium signaling PMID: 15096504
  10. RGS17, an overexpressed gene in human lung and prostate cancer, induces tumor cell proliferation through the cyclic AMP-PKA-CREB pathway. PMID: 19244110
  11. RGS17 is a major candidate for the familial lung cancer susceptibility locus on chromosome 6q23-25. PMID: 19351763

Show More

Hide All

Subcellular Location
Membrane. Cell junction, synapse, synaptosome. Nucleus. Cytoplasm.
Tissue Specificity
Predominantly expressed in the cerebellum. Also expressed in the cortex and medulla. Weakly expressed in a number of peripheral tissues notably spleen, lung and leukocytes.
Database Links

HGNC: 14088

OMIM: 607191

KEGG: hsa:26575

STRING: 9606.ENSP00000206262

UniGene: Hs.166313

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*