Name: Recombinant Human Regulator of G-protein signaling 17(RGS17) (Active)
Brand: CUSABIO
SKU: CSB-EP019648HU

Product Details

Purity	Greater than 85% as determined by SDS-PAGE.
Activity	Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 μg/ml can bind human RGS17, the EC50 of human RGS17 protein is 31.63-34.44 μg/ml.
Target Names	RGS17
Uniprot No.	Q9UGC6
Research Area	Signal Transduction
Alternative Names	hRGS17; Regulator of G protein signalling 17; Regulator of G protein signalling Z2; Regulator of G-protein signaling 17; RGS-17; RGS17; RGS17_HUMAN; RGSZ2
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	1-210aa
Target Protein Sequence	MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Mol. Weight	51.4 kDa
Protein Length	Full Length
Tag Info	N-terminal GST-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	Tris-based buffer,50% glycerol
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	3-7 business days
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Binds selectively to GNAZ and GNAI2 subunits, accelerates their GTPase activity and regulates their signaling activities. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
Gene References into Functions	data suggest that RGS17 is overexpressed in colorectal carcinoma and promotes cell proliferation, migration, and invasion PMID: 28337960 Results showed that RGS17 overexpression promoted hepatocarcinoma (HCC) cell proliferation, migration, and invasion, and reversed the miR-199 mediated inhibition of proliferation, migration, and invasion. PMID: 29559347 Taken together, the results suggested that expression of miR-203 inhibited non-small-cell lung cancer tumor growth and metastasis by targeting RGS17 PMID: 28921827 Variation in RGS17 was associated with risk for substance dependence diagnoses in both African American and European American populations. PMID: 22591552 Two single nucleotide polymorphisms in the regulator of G-protein signaling 17 gene are associated with smoking initiation. PMID: 22006218 RGS17 is differentially expressed in hepatocellular carcinoma cells and plays a central role in regulating transformed hepatocyte tumorgenicity. PMID: 21620966 Results establish RGS10 and RGS17 as novel regulators of cell survival and chemoresistance in ovarian cancer cells and suggest that their reduced expression may be diagnostic of chemoresistance. PMID: 21044322 Taken together, these data have provided the first evidence of miRNA regulation of RGS17 expression in lung cancer. PMID: 20420807 RGS17 is a new RZ member that preferentially inhibits receptor signaling via G(i/o), G(z), and G(q) over G(s) to enhance cAMP-dependent signaling and inhibit calcium signaling PMID: 15096504 RGS17, an overexpressed gene in human lung and prostate cancer, induces tumor cell proliferation through the cyclic AMP-PKA-CREB pathway. PMID: 19244110 RGS17 is a major candidate for the familial lung cancer susceptibility locus on chromosome 6q23-25. PMID: 19351763 Show More Hide All
Subcellular Location	Membrane. Cell junction, synapse, synaptosome. Nucleus. Cytoplasm.
Tissue Specificity	Predominantly expressed in the cerebellum. Also expressed in the cortex and medulla. Weakly expressed in a number of peripheral tissues notably spleen, lung and leukocytes.
Database Links	HGNC: 14088 OMIM: 607191 KEGG: hsa:26575 STRING: 9606.ENSP00000206262 UniGene: Hs.166313

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP019648HU
Size	US$2062Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 μg/ml can bind human RGS17, the EC₅₀ of human RGS17 protein is 31.63-34.44 μg/ml.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Regulator of G-protein signaling 17(RGS17) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage