Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 (CSB-MP023986HU1(F2)) at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml.
Alternative Names
(Osteoclastogenesis inhibitory factor)(Osteoprotegerin)(OCIF)(OPG)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
22-401aa
Target Protein Sequence
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-Flag-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human TNFRSF11B is expressed from mammalian cells and fused with a hFc-Flag-tag at the C-terminus. It contains amino acid residues 22-401 of the human TNFRSF11B protein. Its protein length covers the full length of the mature TNFRSF11B protein. The purity of this TNFRSF11B protein is greater than 90% determined by SDS-PAGE. The endotoxin content of recombinant TNFRSF11B protein is less than 1.0 EU/ug measured by the LAL method. Importantly, it has been validated to be active. In the functional ELISA, immobilized TNFSF11 can bind to this human TNFRSF11B, with the EC50 of 2.651-7.646 ng/ml. And it is in stock now.
TNFRSF11B, also termed Osteoprotegerin (OPG), OPG binding to RANKL inhibits the activation of osteoclasts and promotes apoptosis of osteoclasts, whereas the ligation with TRAIL blocks apoptosis of tumor cells. OPG is implicated in the pathogenesis of atherosclerosis and cardiovascular diseases. Involvement of OPG has also been found in several types of human cancer, including gastric cancer, and OPG has been associated with the development and progression of tumor cells.