Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) (Active)

In Stock
Code CSB-MP023969HU
MSDS
Size $228
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 (CSB-MP023986HU1(F2)) at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 (CSB-MP023986HU1(F2)) at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml.
Target Names
TNFRSF11B
Uniprot No.
Alternative Names
(Osteoclastogenesis inhibitory factor)(Osteoprotegerin)(OCIF)(OPG)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
22-401aa
Target Protein Sequence
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Mol. Weight
73.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-Flag-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human TNFRSF11B is expressed from mammalian cells and fused with a hFc-Flag-tag at the C-terminus. It contains amino acid residues 22-401 of the human TNFRSF11B protein. Its protein length covers the full length of the mature TNFRSF11B protein. The purity of this TNFRSF11B protein is greater than 90% determined by SDS-PAGE. The endotoxin content of recombinant TNFRSF11B protein is less than 1.0 EU/ug measured by the LAL method. Importantly, it has been validated to be active. In the functional ELISA, immobilized TNFSF11 can bind to this human TNFRSF11B, with the EC50 of 2.651-7.646 ng/ml. And it is in stock now.

TNFRSF11B, also termed Osteoprotegerin (OPG), OPG binding to RANKL inhibits the activation of osteoclasts and promotes apoptosis of osteoclasts, whereas the ligation with TRAIL blocks apoptosis of tumor cells. OPG is implicated in the pathogenesis of atherosclerosis and cardiovascular diseases. Involvement of OPG has also been found in several types of human cancer, including gastric cancer, and OPG has been associated with the development and progression of tumor cells.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: After receiving the product, functional ELISA experiments were conducted with Human TNFSF11, and the EC50 was 3.935-7.640 ng/ml, indicating good binding activity. Subsequently used for antibody screening, ideal clones were screened, and the stability between batches was good!

By Anonymous

Target Background

Function
Acts as decoy receptor for TNFSF11/RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local ratio between TNFSF11 and TNFRSF11B. May also play a role in preventing arterial calcification. May act as decoy receptor for TNFSF10/TRAIL and protect against apoptosis. TNFSF10/TRAIL binding blocks the inhibition of osteoclastogenesis.
Gene References into Functions
  1. REVIEW: role of osteoprotegerin in the crosstalk between vessels and bone: circulating OPG levels could be used as independent biomarkers of cardiovascular disease in patients with acute or chronic cardiometabolic disease and thus an improved prognosis PMID: 28867452
  2. OPG is one promising susceptibility gene of bone mineral density or osteoporotic fractures. PMID: 28496203
  3. The concentration of circulating osteoprotegerin can be a biomarker for both medial artery calcification and atherosclerosis in patients with chronic kidney disease (CKD); OPG might be an early indicator of all-cause mortality in CKD patients with advanced medial arterial calcification PMID: 29974642
  4. We conclude that non-small cell lung cancer patients have a higher content of OPG in bronchoalveolar lavage fluid than healthy people. PMID: 29052177
  5. positive correlation of OPG with age and an inverse correlation with IGF-I favor the compensatory response of OPG against bone loss in the aging skeleton PMID: 29895074
  6. The results indicated that mice treated with low levels of human recombinant OPG may have a more stable aneurysmal phenotype due to compensatory production of collagen and increased vessel wall thickness of the aorta, potentially protecting the aneurysm from rupture. PMID: 29749489
  7. TNF-alpha, DKK1, and OPG have roles in pathogenesis of knee osteoarthritis PMID: 28676900
  8. OPG mRNA expression was higher in tumour tissue from patients with metastatic prostate cancer compared to local disease. The RANKL/OPG ratio was low in normal prostate tissue and high in tumours with bone metastases. Expression was high in BPH tissue but did not exceed as much as in the tumour tissue. PMID: 29204705
  9. results of this study concluded that the RANK, RANK-L and OPG system participates in bone remodeling after RME PMID: 29297549
  10. In cardiovascular risks, OPG serum level might increase as a preventive compensatory mechanism to neutralize the RANKL level increment. The determination of the OPG-RANKL system is a diagnostic indicator for the intensity of vascular calcification and atherosclerosis in SSc patients. PMID: 29336616
  11. Demonstrate that rs3134069 in TNFRSF11B increases risk of ischemic stroke by decreasing TNFRSF11B expression. PMID: 29501268
  12. sRANKL and OPG may play a role in the pathogenesis of diabetes as well as metabolic disturbance PMID: 28146138
  13. The study revealed an enhanced sensitivity of aortic valve interstitial cells to osteogenic inductors in aortic stenosis patients, which indicates probable implication of OPN, OPG, and BMP2 genes in pathogenesis of aortic valve calcification. PMID: 29308559
  14. Patients with metabolic syndrome have increased osteoprotegerin serum levels than healthy individuals; osteoprotegerin plays an important role in the development of arteriosclerosis, and the effect of osteoprotegerin on intima media thickness strongly depends on the extent of arteriosclerotic changes in metabolic syndrome PMID: 29077157
  15. In African-Americans, higher OPG levels were associated with characteristics common in patients with heart failure with preserved ejection fraction (HFpEF) and were significantly associated with known precursors to HFpEF. PMID: 28787318
  16. rs2073618 not associated with bone mineral density PMID: 28488893
  17. TRACP-5b level is significantly associated with the OPG level and with the severity and extent of coronary atherosclerosis in coronary artery disease patients PMID: 28428481
  18. Vascular smooth cells are a significant source of osteoprotegerin within the vasculature but that RANKL, once present, downregulates this production and appears capable of preventing the "protective" upregulation of OPG seen with VSMCs exposed to physiological levels of cyclic strain. PMID: 29635231
  19. higher serum OPG levels represent an independent risk factor for cardiovascular and fracture risk. PMID: 28677166
  20. For the OPG gene, an association was observed between the group with chronic arthralgia and joint TMD and the control group (P=0.04). There was also a tendency towards an association of the haplotype CGCCAA with an increased risk of developing chronic joint pain, even in the absence of TMD (P=0.06). PMID: 28464982
  21. Vitamin D, tumor necrosis factor (TNF)-alpha, receptor activator of nuclear factor-KB ligand (RANKL), and OPG levels were determined in GCF and serum. Baseline clinical parameters were similar in all periodontitis groups (P > 0.05) but were higher than that in controls PMID: 28904316
  22. Adipose-derived stem cell-released osteoprotegerin protects cardiomyocytes from reactive oxygen species-induced cell death. PMID: 28931423
  23. down-regulated miR-143-5p promotes the differentiation of DPSCs into odontoblasts by enhancing Runx2 expression via the OPG/RANKL signaling pathway. PMID: 28608628
  24. OPG and OPG/TRAIL ratio expression were significantly increased in rheumatoid arthritis patients compared to controls (fold change = 1.79, p = 0.013 and 2.07, p = 0.030, respectively), RANKL/OPG ratio was significantly decreased (fold change = 0.50, p = 0.020). No significant differences were found between patients and controls in RANKL and TRAIL expression. PMID: 27403809
  25. Elevated OPG was a strong and independent predictor of longterm cardiovascular mortality, even after adjustment for traditional risk factors. Low levels of both OPG and act vWF were associated with a 99 % survival rate during the follow-up of five years. PMID: 28726980
  26. This study revealed a significant elevation of circulating OPG in septic patients with different levels of severity and those who progressed to AKI. PMID: 28840836
  27. Studied association between osteoprotegerin gene polymorphisms and osteoporosis in Roma and non-Roma postmenopausal women in Eastern Slovakia. PMID: 27859736
  28. In type 2 diabetes patients HMGB-1 and OPG serum levels are higher in patients affected by peripheral arterial disease and independently associated with its occurrence and clinical severity PMID: 28789654
  29. The epicardial adipose tissue expresses the mRNA of osteopontin, osteoprotegerin, and osteonectin genes that have been implicated in the calcification process; such expression is statistically associated with some components of HDL subclasses in coronary artery disease patients. PMID: 28821297
  30. Serum osteoprotegerin level is significantly associated with both the presence and severity of peripheral arterial disease in patients with type 2 diabetes. PMID: 29313442
  31. Serum osteoprotegerin was the strongest risk factor associated with new development and rapid progression of arterial calcification in incident peritoneal dialysis patients. PMID: 28614819
  32. concluded that in Mexican-Mestizo female patients with rheumatoid arthritis, the rs2073618 polymorphism of the TNRFS11B gene is not associated with low bone mineral density PMID: 28758134
  33. Osteoprotegerin was associated with chronic kidney disease in hypertensive patients. PMID: 28683789
  34. Data suggest that, in children with type I diabetes, serum levels of osteoprotegerin are up-regulated, serum levels of RANKL are unchanged, and serum levels of fetuin-A are down-regulated. (RANKL = receptor activator of nuclear factor kappa B ligand) PMID: 27028343
  35. Data indicate a significant inverse relationship between plasma osteoprotegerin (OPG) levels and breast cancer risk among women with an inherited BRCA1 or BRCA2 mutation. PMID: 27893411
  36. Progressive calcification of atherosclerotic plaques is accompanied by insignificant accumulation of calcitonin and osteoprotegerin, whereas the osteocalcin expression significantly increased during calcification. PMID: 28429221
  37. Elevated serum ferritin concentrations and bone remodeling marker, osteoprotegerin, are independent predictors of hip fracture in postmenopausal women hospitalized for fragility fracture. PMID: 27503623
  38. Results showed that colorectal liver metastasis tissues exhibited significantly reduced expression of osteoprotegerin compared to primary colorectal carcinomas and normal colorectal mucosa. This reduced expression was significantly associated with the extent of colorectal liver metastasis, including multiplicity of metastatic tumors, involvement of the bilateral hepatic lobes, and higher histological grade. PMID: 27764814
  39. Data indicate that the RANKL/RANK/OPG system is deregulated in post-menopausal women at high risk for breast cancer and in women with circulating tumor cells. Thus, serum levels of RANKL/OPG are potentially indicative of predisposition and progression of breast cancer in humans. PMID: 28002811
  40. High OPG expression is associated with triple negative breast cancer. PMID: 27015557
  41. show for the first time that OPG improves risk stratification for cardiovascular events in a non-dialysis chronic kidney disease population PMID: 27016924
  42. OPG has a role in cancer progression, especially breast cancer [review] PMID: 27072583
  43. OPG rs2073618 polymorphism could be a possible genetic marker for the prediction of increased risk for carotid plaque burden as a measure of advanced subclinical atherosclerosis in T2DM subjects. PMID: 28593808
  44. The compound with greatest potential is E05657 with high activity and low effective concentration in the HTS system. It increases the OPG/RANKL ratio and OPG secretion, decreases the NFATc1 expression, and reduces osteoclastogenesis in vitro PMID: 27301430
  45. OPG T950C polymorphism might be associated with an increased osteoporosis risk in the Chinese population PMID: 29253005
  46. We have concluded that low OPG levels may be associated with osteoporosis in ulcerative colitis, but it is not correlated with the c.-223C > T polymorphism in the TNFRSF11B gene. PMID: 27639566
  47. RANKL/Osteoprotegerin have roles in bone turnover in Hashimoto Thyroiditis PMID: 27328677
  48. High OPG expression is associated with colorectal carcinoma. PMID: 26942563
  49. Data suggest that elevated plasma levels of osteoprotegerin/TNFRSF11B correlate with increased risk of cardiovascular comorbidities in children and adolescents with type 1 diabetes (as compared to healthy control subjects); thus, osteoprotegerin/TNFRSF11B may serve as biomarker of cardiovascular risk in these patients. This study was conducted in Tunisia. PMID: 27111559
  50. Studies showed that the central hypothalamic-pituitary regulatory system, via it's relative hormones, seems to control OPG/RANKL/RANK system function, and the pulsatility and circadian rhythmicity of these hormones may induce an oscillatory fluctuation of the OPG/ RANKL ratio. Also, psycological characteristics may provoke a shift of the OPG/ RANKL ratio towards an unbalanced or a balanced status. [review] PMID: 27862210

Show More

Hide All

Involvement in disease
Paget disease of bone 5, juvenile-onset (PDB5)
Subcellular Location
Secreted.
Tissue Specificity
Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal muscle. Highly expres
Database Links

HGNC: 11909

OMIM: 239000

KEGG: hsa:4982

STRING: 9606.ENSP00000297350

UniGene: Hs.81791

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*